NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0065203_1439787

Scaffold Ga0065203_1439787


Overview

Basic Information
Taxon OID3300004449 Open in IMG/M
Scaffold IDGa0065203_1439787 Open in IMG/M
Source Dataset NameMarine microbial communities from Galveston Bay (CSEDA12C HDTS- fraction 12)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterShell Corporation
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)509
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Sediment → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Source Dataset Sampling Location
Location NameGalveston Bay, USA
CoordinatesLat. (o)29.5Long. (o)-94.76Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017291Metagenome / Metatranscriptome241Y

Sequences

Protein IDFamilyRBSSequence
Ga0065203_14397871F017291AGGMPVIANNISLTAGSSSVNVFDNTNYQFVNEGTELRVSAAVVGANDGIQGANVNYRFTINNTEFADDAIVPALVTGE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.