Scaffold Ga0065861_1003014

Overview

Basic Information

• Taxon OID: 3300004448
• Scaffold ID: Ga0065861_1003014
• Source Dataset Name: Marine viral communities from Newfoundland, Canada BC-1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Yale University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1584
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Viral Communities From Newfoundland, Canada

Source Dataset Sampling Location

• Location Name: Newfoundland, Canada
• Coordinates
  • Lat. (^o): 47.593411
  • Long. (^o): -52.885466

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071260	Metagenome / Metatranscriptome	122	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0065861_10030145	F071260	N/A	MFFEDAQDAWELFRISPELTCTCDEVHICQQCFEEDKNNLKL*