| Basic Information | |
|---|---|
| Taxon OID | 3300004340 Open in IMG/M |
| Scaffold ID | Ga0066239_1006710 Open in IMG/M |
| Source Dataset Name | Sediment microbial communities from the mangroves in Sao Paulo State, Brazil - MgvRC4A |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 591 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Sediment → Mangrove Sediment → Metatranscriptomics Studies In Sediment Microbial Communities From The Mangroves In Sao Paulo, Brazil |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sao Paulo State, Brazil | |||||||
| Coordinates | Lat. (o) | -23.8553 | Long. (o) | -46.1394 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001758 | Metagenome / Metatranscriptome | 640 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0066239_10067102 | F001758 | N/A | ERLGQAGWLNPSKAESKGKVEEAGFTSSSGGVRAPSVTRSVELNGEER* |
| ⦗Top⦘ |