Scaffold Ga0066639_10015783

Overview

Basic Information

• Taxon OID: 3300004210
• Scaffold ID: Ga0066639_10015783
• Source Dataset Name: Groundwater microbial communities from aquifer - Crystal Geyser CG10_big_fil_rev_8/21/14_0.10
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5893
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Development Of A Pipeline For High-Throughput Recovery Of Near-Complete And Complete Microbial Genomes From Complex Metagenomic Datasets

Source Dataset Sampling Location

• Location Name: USA: Utah: Grand County
• Coordinates
  • Lat. (^o): 38.9383
  • Long. (^o): -110.1342

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040819	Metagenome	161	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066639_100157833	F040819	AGGAG	MTKAQEIYEKVEALVATGVPKADAFRQVAEEFGQPFNSMRGAYYAHSRTITGGSSRPRRRQTTTADAVESAAQLLRRALESIDDEVLAAKARAEEAKAEYEALRDSVKERKAAIEAKIDALTS*