Scaffold Ga0066649_10384781

Overview

Basic Information

• Taxon OID: 3300004209
• Scaffold ID: Ga0066649_10384781
• Source Dataset Name: Groundwater microbial communities from aquifer - Crystal Geyser CG22_combo_CG10-13_8/21/14_all
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 727
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Riflebacteria → unclassified Candidatus Riflebacteria → Candidatus Riflebacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Development Of A Pipeline For High-Throughput Recovery Of Near-Complete And Complete Microbial Genomes From Complex Metagenomic Datasets

Source Dataset Sampling Location

• Location Name: USA: Utah: Grand County
• Coordinates
  • Lat. (^o): 38.9383
  • Long. (^o): -110.1342

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009876	Metagenome	311	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066649_103847812	F009876	GGA	MSAKFLGSASNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET*