| Basic Information | |
|---|---|
| Taxon OID | 3300004169 Open in IMG/M |
| Scaffold ID | Ga0066436_1010691 Open in IMG/M |
| Source Dataset Name | Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 52_LOW8 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 920 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Lake Washington, Seattle, Washington | |||||||
| Coordinates | Lat. (o) | 48.3807 | Long. (o) | -122.1599 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021521 | Metagenome / Metatranscriptome | 218 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0066436_10106912 | F021521 | N/A | MAGYLHRTATTAYLAAFLPWGGSAGAGRVRPAAAKVRVEPVFS* |
| ⦗Top⦘ |