Basic Information | |
---|---|
Taxon OID | 3300004090 Open in IMG/M |
Scaffold ID | Ga0064458_1198740 Open in IMG/M |
Source Dataset Name | Eurytemora affinis associated microbial communities from Braddock Bay, NY (Lake Ontario) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Maryland School of Medicine |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 604 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Arthropoda → Unclassified → Unclassified → Unclassified → Eurytemora Affinis Associated → Eurytemora Affinis Associated Microbial Communities From Braddock Bay, Ny (Lake Ontario) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Braddock Bay, NY, USA | |||||||
Coordinates | Lat. (o) | 43.30746 | Long. (o) | -77.707341 | Alt. (m) | Depth (m) | 2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F037597 | Metagenome | 167 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0064458_11987402 | F037597 | N/A | MEFEEFEPQFKSAKIRQNPFKLSAGLNLETFDTILSGTNHI |
⦗Top⦘ |