Scaffold Ga0064458_1165437

Overview

Basic Information

• Taxon OID: 3300004090
• Scaffold ID: Ga0064458_1165437
• Source Dataset Name: Eurytemora affinis associated microbial communities from Braddock Bay, NY (Lake Ontario)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Maryland School of Medicine
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 676
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Arthropoda → Unclassified → Unclassified → Unclassified → Eurytemora Affinis Associated → Eurytemora Affinis Associated Microbial Communities From Braddock Bay, Ny (Lake Ontario)

Source Dataset Sampling Location

• Location Name: Braddock Bay, NY, USA
• Coordinates
  • Lat. (^o): 43.30746
  • Long. (^o): -77.707341
  • Depth (m): 2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058717	Metagenome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0064458_11654371	F058717	N/A	SWFLRETRLSIEPYSPLKPTKVGLIFIGPNSFSRAEDLAAVNHLTQAVVRVGSKIGS*