| Basic Information | |
|---|---|
| Taxon OID | 3300004069 Open in IMG/M |
| Scaffold ID | Ga0063354_1121111 Open in IMG/M |
| Source Dataset Name | Combined assembly of 1362B_J2.571 and 1362A_J2.573 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 521 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Oceanic, Basalt-Hosted Subsurface Hydrothermal Fluid → Deep Subsurface And Oceanic Microbial Communities From Witwatersrand Basin, South Africa, And The Canadian And Fennoscandian Shields And At The Lost City Hydrothermal Field |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Juan de Fuca Ridge flank, Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 47.76 | Long. (o) | -127.76 | Alt. (m) | Depth (m) | 454 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003647 | Metagenome / Metatranscriptome | 475 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0063354_11211112 | F003647 | N/A | RASNKAFAKVTMLKLDIDDYKRSLINGTYGGITYEEAEQVLEGYKTELKVWNYITELIEKQ* |
| ⦗Top⦘ |