Scaffold Ga0063354_1085309

Overview

Basic Information

• Taxon OID: 3300004069
• Scaffold ID: Ga0063354_1085309
• Source Dataset Name: Combined assembly of 1362B_J2.571 and 1362A_J2.573
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 655
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Oceanic, Basalt-Hosted Subsurface Hydrothermal Fluid → Deep Subsurface And Oceanic Microbial Communities From Witwatersrand Basin, South Africa, And The Canadian And Fennoscandian Shields And At The Lost City Hydrothermal Field

Source Dataset Sampling Location

• Location Name: Juan de Fuca Ridge flank, Pacific Ocean
• Coordinates
  • Lat. (^o): 47.76
  • Long. (^o): -127.76
  • Depth (m): 454

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056895	Metagenome / Metatranscriptome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0063354_10853091	F056895	GAG	MEMELKQIPKPHKTTNPKHREDYVFVEKPGEDFTALKLISGPFSSIVYKYGAVGFRPESEKRPDGTLPMQFDYDIIENKIDADIDSQ