Scaffold Ga0055485_10133537

Overview

Basic Information

• Taxon OID: 3300004067
• Scaffold ID: Ga0055485_10133537
• Source Dataset Name: Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 663
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands → Natural And Restored Wetland Microbial Communities From The San Francisco Bay, California, Usa, That Impact Long-Term Carbon Sequestration

Source Dataset Sampling Location

• Location Name: USA: San Francisco Bay, California
• Coordinates
  • Lat. (^o): 38.209766
  • Long. (^o): -122.033424

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072499	Metagenome / Metatranscriptome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0055485_101335371	F072499	N/A	GGNMKTRVEPGRRVRPVASILARPQEVLGESLPELVLLSAVVAAVVSAAVALNGAG*