NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F072499

Metagenome / Metatranscriptome Family F072499

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F072499
Family Type Metagenome / Metatranscriptome
Number of Sequences 121
Average Sequence Length 53 residues
Representative Sequence MTTRSAFGRRLSRPAAKVLARPRELFGESIPELLLVTAVVAAVVSAVLALNGAG
Number of Associated Samples 96
Number of Associated Scaffolds 121

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 87.60 %
% of genes near scaffold ends (potentially truncated) 25.62 %
% of genes from short scaffolds (< 2000 bps) 86.78 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.215 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(28.099 % of family members)
Environment Ontology (ENVO) Unclassified
(29.752 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(29.752 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 48.78%    β-sheet: 0.00%    Coil/Unstructured: 51.22%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 121 Family Scaffolds
PF00085Thioredoxin 33.06
PF00126HTH_1 26.45
PF02566OsmC 16.53
PF03466LysR_substrate 15.70
PF02353CMAS 2.48
PF13414TPR_11 0.83
PF03950tRNA-synt_1c_C 0.83
PF01967MoaC 0.83
PF05684DUF819 0.83
PF01565FAD_binding_4 0.83
PF00137ATP-synt_C 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 121 Family Scaffolds
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 16.53
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 16.53
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 2.48
COG22272-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylaseCoenzyme transport and metabolism [H] 2.48
COG2230Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferasesLipid transport and metabolism [I] 2.48
COG0008Glutamyl- or glutaminyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.83
COG0315Molybdenum cofactor biosynthesis enzyme MoaCCoenzyme transport and metabolism [H] 0.83
COG0636FoF1-type ATP synthase, membrane subunit c/Archaeal/vacuolar-type H+-ATPase, subunit KEnergy production and conversion [C] 0.83
COG5505Uncharacterized membrane protein YjcLFunction unknown [S] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.21 %
UnclassifiedrootN/A5.79 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000881|JGI10215J12807_1093197Not Available550Open in IMG/M
3300000956|JGI10216J12902_100668127All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp.2175Open in IMG/M
3300000956|JGI10216J12902_106753966All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1021Open in IMG/M
3300000956|JGI10216J12902_108346029All Organisms → cellular organisms → Bacteria1066Open in IMG/M
3300004067|Ga0055485_10133537All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300004114|Ga0062593_101352805All Organisms → cellular organisms → Bacteria → Proteobacteria758Open in IMG/M
3300004463|Ga0063356_101467996All Organisms → cellular organisms → Bacteria1008Open in IMG/M
3300004463|Ga0063356_102185588All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300004643|Ga0062591_100541536All Organisms → cellular organisms → Bacteria1012Open in IMG/M
3300005093|Ga0062594_101078666All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300005334|Ga0068869_101568056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium586Open in IMG/M
3300005345|Ga0070692_10017599All Organisms → cellular organisms → Bacteria3421Open in IMG/M
3300005406|Ga0070703_10014361All Organisms → cellular organisms → Bacteria2256Open in IMG/M
3300005441|Ga0070700_101088806All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300005444|Ga0070694_100035325All Organisms → cellular organisms → Bacteria → Proteobacteria3303Open in IMG/M
3300005458|Ga0070681_10831780All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp.841Open in IMG/M
3300005459|Ga0068867_100468467All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1077Open in IMG/M
3300005530|Ga0070679_101505914All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium620Open in IMG/M
3300006196|Ga0075422_10183031All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300006806|Ga0079220_10216263All Organisms → cellular organisms → Bacteria1120Open in IMG/M
3300006854|Ga0075425_101658154All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium720Open in IMG/M
3300006865|Ga0073934_10001054All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria70194Open in IMG/M
3300007004|Ga0079218_10030218All Organisms → cellular organisms → Bacteria → Proteobacteria3125Open in IMG/M
3300007004|Ga0079218_10204324All Organisms → cellular organisms → Bacteria → Proteobacteria1511Open in IMG/M
3300007004|Ga0079218_10534175All Organisms → cellular organisms → Bacteria → Proteobacteria1049Open in IMG/M
3300007004|Ga0079218_12028574All Organisms → cellular organisms → Bacteria → Proteobacteria658Open in IMG/M
3300009087|Ga0105107_10602662All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium765Open in IMG/M
3300009148|Ga0105243_10294425All Organisms → cellular organisms → Bacteria1468Open in IMG/M
3300009610|Ga0105340_1077052All Organisms → cellular organisms → Bacteria → Proteobacteria1319Open in IMG/M
3300009678|Ga0105252_10128142All Organisms → cellular organisms → Bacteria1041Open in IMG/M
3300010144|Ga0115593_1204518Not Available565Open in IMG/M
3300010399|Ga0134127_10067693All Organisms → cellular organisms → Bacteria → Proteobacteria3021Open in IMG/M
3300010399|Ga0134127_11099062All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium859Open in IMG/M
3300010400|Ga0134122_10640869All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp.988Open in IMG/M
3300010403|Ga0134123_10456923All Organisms → cellular organisms → Bacteria1189Open in IMG/M
3300011428|Ga0137456_1087953All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp.790Open in IMG/M
3300011440|Ga0137433_1279017All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium544Open in IMG/M
3300011441|Ga0137452_1142158All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium805Open in IMG/M
3300012212|Ga0150985_115635189All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300012232|Ga0137435_1071339All Organisms → cellular organisms → Bacteria → Proteobacteria1029Open in IMG/M
3300012882|Ga0157304_1063234All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium599Open in IMG/M
3300012910|Ga0157308_10071349All Organisms → cellular organisms → Bacteria → Proteobacteria958Open in IMG/M
3300012912|Ga0157306_10406157Not Available534Open in IMG/M
3300012913|Ga0157298_10039272All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1029Open in IMG/M
3300012914|Ga0157297_10110450All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp.840Open in IMG/M
3300012915|Ga0157302_10376834Not Available577Open in IMG/M
3300012943|Ga0164241_10699094All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300013096|Ga0157307_1131008All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium565Open in IMG/M
3300014297|Ga0075306_1022084All Organisms → cellular organisms → Bacteria → Proteobacteria984Open in IMG/M
3300014326|Ga0157380_10877533All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium921Open in IMG/M
3300014864|Ga0180068_1036056All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300015200|Ga0173480_10620309All Organisms → cellular organisms → Bacteria → Proteobacteria666Open in IMG/M
3300015371|Ga0132258_10363047All Organisms → cellular organisms → Bacteria3586Open in IMG/M
3300015372|Ga0132256_102239437All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661651Open in IMG/M
3300017965|Ga0190266_11300255All Organisms → cellular organisms → Bacteria → Proteobacteria511Open in IMG/M
3300018422|Ga0190265_10303931All Organisms → cellular organisms → Bacteria1666Open in IMG/M
3300018429|Ga0190272_11738812All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300018432|Ga0190275_11580253All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300018476|Ga0190274_10657001All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1085Open in IMG/M
3300018476|Ga0190274_12701862All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria593Open in IMG/M
3300018481|Ga0190271_10057709All Organisms → cellular organisms → Bacteria → Proteobacteria3351Open in IMG/M
3300018481|Ga0190271_10632515All Organisms → cellular organisms → Bacteria → Proteobacteria1191Open in IMG/M
3300019356|Ga0173481_10004555All Organisms → cellular organisms → Bacteria → Proteobacteria3647Open in IMG/M
3300019361|Ga0173482_10123805All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales972Open in IMG/M
3300019377|Ga0190264_10152182All Organisms → cellular organisms → Bacteria1195Open in IMG/M
3300019377|Ga0190264_10879846All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium696Open in IMG/M
3300020060|Ga0193717_1098031All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium931Open in IMG/M
3300020064|Ga0180107_1203549All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium541Open in IMG/M
3300020065|Ga0180113_1065375All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium518Open in IMG/M
3300020146|Ga0196977_1098304All Organisms → cellular organisms → Bacteria → Proteobacteria679Open in IMG/M
3300023260|Ga0247798_1054810All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300023266|Ga0247789_1079542All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300025165|Ga0209108_10195996All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1046Open in IMG/M
3300025310|Ga0209172_10003473All Organisms → cellular organisms → Bacteria → Proteobacteria23954Open in IMG/M
3300025885|Ga0207653_10096068All Organisms → cellular organisms → Bacteria1043Open in IMG/M
3300025907|Ga0207645_11202361All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp.509Open in IMG/M
3300025917|Ga0207660_10184384All Organisms → cellular organisms → Bacteria1622Open in IMG/M
3300025917|Ga0207660_10234927All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1442Open in IMG/M
3300025936|Ga0207670_10402799Not Available1094Open in IMG/M
3300025942|Ga0207689_10935435All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium731Open in IMG/M
3300026089|Ga0207648_10163522All Organisms → cellular organisms → Bacteria1966Open in IMG/M
3300026118|Ga0207675_101221586All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium772Open in IMG/M
3300027614|Ga0209970_1015430Not Available1271Open in IMG/M
3300027886|Ga0209486_10117256All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1432Open in IMG/M
3300027886|Ga0209486_10261516All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1004Open in IMG/M
3300027886|Ga0209486_10710461All Organisms → cellular organisms → Bacteria → Proteobacteria649Open in IMG/M
3300027886|Ga0209486_11082486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium543Open in IMG/M
3300028812|Ga0247825_10241552Not Available1255Open in IMG/M
3300031455|Ga0307505_10426030All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium633Open in IMG/M
3300031547|Ga0310887_10378303All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria828Open in IMG/M
3300031548|Ga0307408_100278591All Organisms → cellular organisms → Bacteria1392Open in IMG/M
3300031548|Ga0307408_100839784All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium837Open in IMG/M
3300031562|Ga0310886_10848598All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium578Open in IMG/M
3300031731|Ga0307405_10106559All Organisms → cellular organisms → Bacteria1891Open in IMG/M
3300031740|Ga0307468_100494670All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp.968Open in IMG/M
3300031847|Ga0310907_10505002All Organisms → cellular organisms → Bacteria → Proteobacteria647Open in IMG/M
3300031854|Ga0310904_10394763All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300031854|Ga0310904_10688125All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium706Open in IMG/M
3300031892|Ga0310893_10187993All Organisms → cellular organisms → Bacteria → Proteobacteria826Open in IMG/M
3300031913|Ga0310891_10303644All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium563Open in IMG/M
3300031943|Ga0310885_10392369All Organisms → cellular organisms → Bacteria → Proteobacteria738Open in IMG/M
3300032002|Ga0307416_101654007All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300032003|Ga0310897_10209646All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300032005|Ga0307411_11544675All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp.611Open in IMG/M
3300032012|Ga0310902_10646624All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300032017|Ga0310899_10129246All Organisms → cellular organisms → Bacteria1056Open in IMG/M
3300032122|Ga0310895_10788164All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium500Open in IMG/M
3300032144|Ga0315910_10006071All Organisms → cellular organisms → Bacteria → Proteobacteria9814Open in IMG/M
3300032144|Ga0315910_10041294All Organisms → cellular organisms → Bacteria3367Open in IMG/M
3300032144|Ga0315910_10162304All Organisms → cellular organisms → Bacteria1667Open in IMG/M
3300032144|Ga0315910_10162861All Organisms → cellular organisms → Bacteria → Proteobacteria1664Open in IMG/M
3300032144|Ga0315910_10258148All Organisms → cellular organisms → Bacteria1317Open in IMG/M
3300032144|Ga0315910_10319669All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp.1180Open in IMG/M
3300032157|Ga0315912_10016178All Organisms → cellular organisms → Bacteria → Proteobacteria6180Open in IMG/M
3300032157|Ga0315912_10090081All Organisms → cellular organisms → Bacteria2403Open in IMG/M
3300032157|Ga0315912_10108895All Organisms → cellular organisms → Bacteria2171Open in IMG/M
3300032157|Ga0315912_10146231All Organisms → cellular organisms → Bacteria1852Open in IMG/M
3300032157|Ga0315912_10372140All Organisms → cellular organisms → Bacteria1130Open in IMG/M
3300032174|Ga0307470_10418619All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium953Open in IMG/M
3300032211|Ga0310896_10616538All Organisms → cellular organisms → Bacteria → Proteobacteria607Open in IMG/M
3300034176|Ga0364931_0253816All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium578Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil28.10%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil11.57%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil7.44%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil5.79%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.13%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere4.13%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.31%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.31%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.48%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere2.48%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.65%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment1.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.65%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.65%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.65%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.83%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.83%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.83%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.83%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.83%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.83%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.83%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004067Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300010144Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011428Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT615_2EnvironmentalOpen in IMG/M
3300011440Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2EnvironmentalOpen in IMG/M
3300011441Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012232Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2EnvironmentalOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300014297Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLC_D1EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014864Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231A'_16_10DEnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300020060Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2EnvironmentalOpen in IMG/M
3300020064Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT27_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020065Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020146Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13CEnvironmentalOpen in IMG/M
3300023260Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S197-509C-6EnvironmentalOpen in IMG/M
3300023266Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4EnvironmentalOpen in IMG/M
3300025165Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1EnvironmentalOpen in IMG/M
3300025310Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027614Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300034176Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10215J12807_109319713300000881SoilMTTRSVFGRRLSRPAAKVLARPRELFGESIPELLLVTAVVAAVVSAVLALNGAG*
JGI10216J12902_10066812723300000956SoilMTIRTIRSSRPAKAAANVLSRPREMFGESLPELLLVTAVVAAVVSAVLALNGAS*
JGI10216J12902_10675396633300000956SoilMTTRKNLGRRSALPTLGALARPHELFGESLPELLLLLAVVAAVISGLVALNGTA*
JGI10216J12902_10834602933300000956SoilMTTRKDRRFARPIAGALARPRELFGESLPELLLLLAVVAAVISGVVSLNGIS*
Ga0055485_1013353713300004067Natural And Restored WetlandsGGNMKTRVEPGRRVRPVASILARPQEVLGESLPELVLLSAVVAAVVSAAVALNGAG*
Ga0062593_10135280513300004114SoilMTTRSAFGRRLSRPAAKVLARPRELFGESIPELLLVTAVVAAVVSAVLALNGVA*
Ga0063356_10146799633300004463Arabidopsis Thaliana RhizosphereMSARLIFGRRLSRPAAKALARPRELFGESIPELLLVTAVVAAVVSGILALNGAG*
Ga0063356_10218558823300004463Arabidopsis Thaliana RhizosphereMTTRSAFGRRLSRPAAKVLARPRELFGESIPELLLVTAVVAAVVSAVLALNGAG*
Ga0062591_10054153623300004643SoilMSARLIFGRRLSRPAAKALARPRELFGESIPELLLVTAVVAAVVSGVLALNGAG*
Ga0062594_10107866623300005093SoilMSVRFILGRRLSRPAAKALARPRELFGESIPELLLVTAVVAAVVSGVLALNGAG*
Ga0068869_10156805623300005334Miscanthus RhizosphereMTTLVVFGRRFSRPAAKVLARPRELFGESIPELLLVSAVVAAVVSAVLALNG
Ga0070692_1001759943300005345Corn, Switchgrass And Miscanthus RhizosphereMTTLVVFGRRFSRPAAKVLARPRELFGESIPELLLVSAVVAAVVSALLAV
Ga0070703_1001436123300005406Corn, Switchgrass And Miscanthus RhizosphereMTTLVVFGRRFSRPAAKVLARPRELFGESIPELLLVSAVVAAVVSAVLALNGAG*
Ga0070700_10108880613300005441Corn, Switchgrass And Miscanthus RhizosphereMKTEEPNMSARLILGRRLSRPAAKALARPRELFGESIPELLLVTAVVAAVVSGVLALNGAG*
Ga0070694_10003532543300005444Corn, Switchgrass And Miscanthus RhizosphereMSALLIRGRRLSRPAAKALARPRELFGESIPELLLVTAVVAAVVSALLALNGVS*
Ga0070681_1083178013300005458Corn RhizosphereMTTRSVFGRRLSRPAAKVLARPRELFGESIPELLLVTAVVAAVVSAVLA
Ga0068867_10046846733300005459Miscanthus RhizosphereMTTRVAFGRRFSRPAAKVLARPRELFGESIPALLLVTAVVAAVVSAVLALNGAG*
Ga0070679_10150591413300005530Corn RhizosphereRRFSRPAAKVLARPRELFGESIPELLLVSAVVAAVVSALLALNGAG*
Ga0075422_1018303123300006196Populus RhizosphereMSTRLILGRGLSRPVAKALARPRELFGESIPELLLATAVVAAVVSGVLSLTAG*
Ga0079220_1021626323300006806Agricultural SoilMTTLVAFGRRFSRPAAKVLARPRELFGESIPELLLVTAVVAAVASAVLALNGVG*
Ga0075425_10165815423300006854Populus RhizosphereMSALLIRGRRLSRPAAKVLARPRELFGESIPELLLVTAVVAAVVSALLALNGVS*
Ga0073934_10001054693300006865Hot Spring SedimentMDTRTNPGRRVVRPATKAIAKSRALFGESLPELLLVTAVVAGVVSGAAALAAG*
Ga0079218_1003021843300007004Agricultural SoilMTTLVAYGRRFSRPAARVLGRPRELFGESLPELLLLTAVVAAVVSAVLVLNG*
Ga0079218_1020432423300007004Agricultural SoilMTTRELSRRTARLTADALARPRELFGDSLPELLLVTAVLAAVVSAVLTLNNAG*
Ga0079218_1053417513300007004Agricultural SoilIAMTTRVAFGRRFSRPAAKVLSRPRELFGESLPKLLLLMAVVAAVVSALLAL*
Ga0079218_1202857423300007004Agricultural SoilMTTRKNRGRRLARPAAGVLARPRELFGESLPELLLVTAVVAAVVSAVFALDGAG*
Ga0105107_1060266233300009087Freshwater SedimentMTTRVVPRRKVLPRPTRVSARPRELFGESFPELLLVVAVVAAVVSAVLALNGAG*
Ga0105243_1029442523300009148Miscanthus RhizosphereMTTLVVFGRRFSRPAAKVLARPRELFGESIPELLLVTAVVAAVVSAVLALNGAG*
Ga0105340_107705223300009610SoilMTTRNDLGRRSALPTLGALARPRELFGESLPELLLLLAVVAAVISGFVSLNGAG*
Ga0105252_1012814213300009678SoilTRKDFGRRLVRPTVSALAGPRELFGESLPELLLLTAVVVAIVSGVLALNAAG*
Ga0115593_120451813300010144WetlandMEKEARMTTRKNLGPRRVRPTASVLARPRELFGDSLPELLLLAAVVTAVVSAVLALDGAG
Ga0134127_1006769323300010399Terrestrial SoilMTTLVVFGRRFSRPAAKVLARPRELFGESIPELLLVSAVVAAVVSALLALNGAG*
Ga0134127_1109906213300010399Terrestrial SoilMEMTTRVAFGRRFSRPAAKVLARPRELFGESIPELLLVTAVVAAVVSAVLALNGAG*
Ga0134122_1064086923300010400Terrestrial SoilMSALLIRGRRLSRPAAKALARPRELFGESIPELLLVTA
Ga0134123_1045692313300010403Terrestrial SoilRFSRPAAKVLARPRELFGESIPELLRVSAVVAAVVSAVLALNGAG*
Ga0137456_108795323300011428SoilMMTRKDFGRRLVRPTVSALAGPRELFGESLPELLLLTAVVVAIV
Ga0137433_127901723300011440SoilAPRRRLPRPASVLARPRELFGESLPELLLVAAVVAAVVSAVFALNGAG*
Ga0137452_114215833300011441SoilMMTRKDFGRRLVRPTVSALAGPRELFGESLPELLLLTAVVVAIVSGVLALNAAG*
Ga0150985_11563518933300012212Avena Fatua RhizosphereARIAFGRRFSRPAAKVLARPRELFGESIPELLLVTAVVAAVVSAVLALNGAG*
Ga0137435_107133923300012232SoilMDKEVSMTTRNDLGRRRVRPTASVLARPQELFGESLPELLLVAAVVAAVVSAVLALNGAG
Ga0157304_106323413300012882SoilGRRLSRPAAKALARPRELFGESIPELLLVTAVVAAVVSGVLALNGAV*
Ga0157308_1007134923300012910SoilMSVRLTLGRRLSRPAAKVLARPRELFGESIPELLLVTAVVAAVVSGILALNGAG*
Ga0157306_1040615713300012912SoilMSVRLTLGRRLSRPAAKVLARPRELFGESIPELLLVTAVVAAVVSGVLALNGAG*
Ga0157298_1003927223300012913SoilMSARLIFGRRLSRPAAKALARPRELFGESIPELLLVTAVVAAVVSGLLALNGAV*
Ga0157297_1011045023300012914SoilMSARLIFGRRLSRPAAKVLARPRELFGESIPELLLVTAVV
Ga0157302_1037683413300012915SoilMSVRWIFGRRLSRPAAKALARPRELFGESIPELLLVTAVV
Ga0164241_1069909423300012943SoilMSARLIFGRRLSRPAAKALARPRELFGESIPELLLVTAVVAAVVSGVLALSAG*
Ga0157307_113100813300013096SoilMKTEEVTMSVRLTLGRRLSRPAAKVLARPRELFGESIPELLLVTAVVAAVVSGVLALNGAV*
Ga0075306_102208423300014297Natural And Restored WetlandsMKTRVEHGRRVRPVASILARPRELLGESLPELVLLSAVVAAVVSAAVALNGAG*
Ga0157380_1087753313300014326Switchgrass RhizosphereMKTEEVTMSVRFILGRRLSRPAAKALARPRELFGESIPELLLVTAVVAAVVSGVLALNGAG*
Ga0180068_103605633300014864SoilPAFATRRPSWPAPRELFGESLPELLLVAAVVAAVVSAVFALNGAG*
Ga0173480_1062030923300015200SoilMSARLIFGRRLSRPAAKALARPRELFGESIPELLLVTAVVAAVVSGILALNG
Ga0132258_1036304733300015371Arabidopsis RhizosphereMNARVIFGRRFSRPAAKVLARPRELFGESIPELLLVTAVVAAVVSAVLALNGVG*
Ga0132256_10223943723300015372Arabidopsis RhizosphereMNARVIFGRRFSRPAAKVLARPRELFGESIPELLLVTAVVAAVISAVFALNGAG*
Ga0190266_1130025523300017965SoilMTTRNDLGRRSALPTLGALARPRELFGESLPELLLLLAVVAAVISGFVSLNGAG
Ga0190265_1030393123300018422SoilMTTRKDRGRRLARPSAAMLARPRELFGESLPELLLLTAVVAAVVSAVLALSGAG
Ga0190272_1173881223300018429SoilMTTRKNLGRRSARPTLGALARPRELFGESLPELLLLLAVVAAVISGLVSLNGAG
Ga0190275_1158025323300018432SoilMTTRFTPRGLPRPIAKALARPRELFGESLPELLLLTAVLSAVVSAVLALDGVG
Ga0190274_1065700123300018476SoilMTTRNDLGRRSALPTLGALARPRELFGESLPELLLLLAVVAAVISGLASLNGTA
Ga0190274_1270186223300018476SoilMTTRKNLGRSALPTLGVLARPRELFGESLPELLLLLAVVAAVISGL
Ga0190271_1005770943300018481SoilMTTRNALRRRLPRPVAKALARPRELFGESLPELLLLTAVLTAVVSAVLALDGAG
Ga0190271_1063251513300018481SoilMTTRKNLGRRSALPTLEALARPRELFGESLPELLLLLAVVAAVISGLVSLNGTA
Ga0173481_1000455523300019356SoilMSARLIFGRRLSRPAAKALARPRELFGESIPELLLVTAVVAAVVSGILALNGAG
Ga0173482_1012380523300019361SoilMKTEELNMSARLILGRRLSRPAAKALARPRELFGESIPELLLVTAVVAAVVSGVLALNGA
Ga0190264_1015218233300019377SoilMTTRKDLGRRLGRSTLGSTLRTLPRPRELFGQSLPELLLLTAVVAAVVSAVVALSGAG
Ga0190264_1087984613300019377SoilMTTRKDLGRRLGRSTLGSTLGALPRPRELFGESLPELLLLTAVVAAVVSAVVALSGAG
Ga0193717_109803133300020060SoilMSVQVALRRRLPRPASVLARPRELFGESLPELLLVAAVIAAVVSAVFALNGAG
Ga0180107_120354913300020064Groundwater SedimentMMTRKDFGRRLVRPTVSALAGPRELFGESLPELLLLTAVVVAIVSGVLALNAAG
Ga0180113_106537523300020065Groundwater SedimentMSVYVALRRRLPRPASVSVRPRELFGESLPELLLVAAVIAAVVSAVFALNGAG
Ga0196977_109830423300020146SoilMTTRKERRRRVARPIAGALARPRELFGESLPELLLVSAVVAAVISGVAALSGA
Ga0247798_105481023300023260SoilRLIFGRRLSRPAAKALARPRELFGESIPELLLVTAVVAAVVSGILALNGAG
Ga0247789_107954213300023266SoilMSVRLTLGRRLSRPAAKVLARPRELFGESIPELLLVTAVVAAVVSGVLALNGAG
Ga0209108_1019599623300025165SoilMTIRTQRGRHSARSAARLLTRPRELFGESLPELVLLTAIVAAVVSATLALSG
Ga0209172_10003473253300025310Hot Spring SedimentMDTRTNPGRRVVRPATKAIAKSRALFGESLPELLLVTAVVAGVVSGAAALAAG
Ga0207653_1009606813300025885Corn, Switchgrass And Miscanthus RhizosphereMTTLVVFGRRFSRPAAKVLARPRELFGESIPELLLVSAVVAAVVSAVLALNGAG
Ga0207645_1120236123300025907Miscanthus RhizosphereMTTRSAFGRRLSRPAAKVLARPRELFGESIPELLLVTAVVAAVVSAVLALNGVA
Ga0207660_1018438413300025917Corn RhizosphereEMTTRVAFGRRFSRPAAKVLARPRELFGESIPELLLVTAVVAAVVSAVLALNGAG
Ga0207660_1023492723300025917Corn RhizosphereMTTLVVFGRRFSRPAAKVLARPRELFGESIPELLLVSAVVAAVVSALLALNGAG
Ga0207670_1040279923300025936Switchgrass RhizosphereMTTIVVFGRRFSRPAAKVLARPRELFGESIPELLLVSAVVAAVVS
Ga0207689_1093543523300025942Miscanthus RhizosphereMKTEEVTMSVRFILGRRLSRPAAKALARPRELFGESIPELLLVTAVVAAVVSGVLALNGA
Ga0207648_1016352223300026089Miscanthus RhizosphereMTTRVAFGRRFSRPAAKVLARPRELFGESIPELLLVTAVVAAVVSAVLALNGAG
Ga0207675_10122158613300026118Switchgrass RhizosphereFGNLMKTEELNMSARLILGRRLSRPAAKALARPRELFGESIPELLLVTAVVAAVVSGVLALNGAV
Ga0209970_101543023300027614Arabidopsis Thaliana RhizosphereMSARLIFGRRLSRPAAKVLARPRELFGESIPELLLVTAVVAAVVSAVLALNG
Ga0209486_1011725633300027886Agricultural SoilMTTLVAYGRRFSRPAARVLGRPRELFGESLPELLLLTAVVAAVISAVLVLNG
Ga0209486_1026151623300027886Agricultural SoilMTTRELSRRTARLTADALARPRELFGDSLPELLLVTAVLAAVVSAVLTLNNAG
Ga0209486_1071046123300027886Agricultural SoilMTTRKNRGRRLARPAAGVLARPRELFGESLPELLLVTAVVAAVVSAVFALDGAG
Ga0209486_1108248613300027886Agricultural SoilMSARVPARRSLPRPANVLARPREMFGESLPELFLVAAVIAAVVSAVLALNGAG
Ga0247825_1024155213300028812SoilMSVRLILGRRLSRPAAKALARPRELFGESIPELLLVMAVVAAVV
Ga0307505_1042603013300031455SoilMSTRIESFRKSAGPALSVLARPRELFGESLPELALLTAVVAAVVSALVALNGAA
Ga0310887_1037830323300031547SoilMSTRLILGRGLSRPVAKALARPRELFGESIPELLLATAVVAAV
Ga0307408_10027859123300031548RhizosphereMSARLIFGRRLSRPAAKVLARPRELFGESIPELLLVTAVVAAVVSGILALNGAG
Ga0307408_10083978423300031548RhizosphereMTTRNDRGRRLVRPSLGGLARPRELFGESLPELLLLTAVVAAVVSAVLALNGVG
Ga0310886_1084859813300031562SoilMTTRSVFGRRLSRPAAKVLARPRELFGESIPELLLVTAVVAAVVSGVLALNGAV
Ga0307405_1010655923300031731RhizosphereMTTRNDRGRRLVRPTLGSLARPRELFGESLPELLLLTAVVAAVVSAVLALNGAG
Ga0307468_10049467013300031740Hardwood Forest SoilMTTRVAFGRRFSRPAAKVLARPRELFGESIPELLLVTAVVAAVV
Ga0310907_1050500223300031847SoilMTTLVVFGRRFSRPAAKVLARPRELFGESIPELLLVTAVVAAVVSAVLALNGAG
Ga0310904_1039476323300031854SoilMSTRLILGRGLSRPVAKALARPRELFGESIPELLLATAVVAAVVSGVLSLTAG
Ga0310904_1068812523300031854SoilMTTLVVFGRRFSRPAAKVLARPRELFGESIPELLLVSAVVAAVVSAVLALNGTG
Ga0310893_1018799323300031892SoilMSVRFILGRRLSRPAAKALARPRELFGESIPELLLVTAVVAAVVSGVLALNGAG
Ga0310891_1030364423300031913SoilLNMSARLILGRRLSRPAAKALARPRELFGESIPELLLVTAVVAAVVSGVLALNGAV
Ga0310885_1039236923300031943SoilMSARLILGRRLSRPAAKALARPRELFGESIPELLLVTAVVAAVVSGVLALNGAV
Ga0307416_10165400713300032002RhizosphereMTTRKDRGRRIARPIRGALARPQELFGESLPELLLATAVVAAVISGVVALSGAG
Ga0310897_1020964633300032003SoilRFSRPAAKVLARPRELFGESIPELLLVSAVVAAVVSAVLALNGAG
Ga0307411_1154467523300032005RhizosphereMTTRKGRGRRIARPIRGALARPRELFGESLPELLLATAVVAAVISGVVALSGAG
Ga0310902_1064662423300032012SoilMSARLILGRRLSRPAAKALARPRELFGESIPELLLVTAVVAAVVSGVLALNGAG
Ga0310899_1012924623300032017SoilMKKEELNVSARLNLGRRLSRPAAKALARPRELFGESIPELLLVTAVVAAVVSGVFSLSAG
Ga0310895_1078816423300032122SoilMTTLVVFGRRFSRPAAKVLARPRELFGESIPELLLVSAVVAAVVSAVLALN
Ga0315910_1000607153300032144SoilMNARLILGRRLSRPAAKVLARPRELFGESIPELLLVTAVVAAVVSGVLALSGAG
Ga0315910_1004129423300032144SoilMSARIIRSLEPAREAAANVLARPRELFGESIPELLLVTAVVAAVVSAVFVLNGAG
Ga0315910_1016230433300032144SoilMSARLILGRRLSRPAAKALARPRELFGESIPELLLVTAVVAAIVSGVLSLSAG
Ga0315910_1016286123300032144SoilMSTLKNRVRRPARPRADVLARPRELFGESLPELLLVAAVVAAVVSGLFSLNGGI
Ga0315910_1025814823300032144SoilMTTRTTRRSKPARVAANVLARPKELFGESLPELLLVTAVVAAVVSGVLALNGVG
Ga0315910_1031966923300032144SoilMTIRRDRSRRLVRPLETVLPRSRELFGESLPELLLVVAVVAAVVSAVLALNGTG
Ga0315912_1001617833300032157SoilMSARILGRRLAGPAAKVLARPRELFGESLPELLLLTAVVATVVSAVLALNGVA
Ga0315912_1009008143300032157SoilMSARLILGRRLSRPAAKAFARPRELFGESIPELLLVTAVVAAVVSGVLALSAS
Ga0315912_1010889533300032157SoilMSARLILGRRLSRPAAKALARPRELFGESIPELLLVTAVVAAVVSGVLSLSAG
Ga0315912_1014623133300032157SoilMTARVLSRRLARPAAKVLGRPRELFGESLPELLLVTAVVAAVISALFTLNGAS
Ga0315912_1037214033300032157SoilMSARLILGRRLSRPAAKALARPRELFGESIPELLLVSAVVAAVVSGVLALNGAG
Ga0307470_1041861923300032174Hardwood Forest SoilMKARVIFGRRFSRPAAKVLARPRELFGESIPELLLVTAVVAAVISAVLALNGAG
Ga0310896_1061653813300032211SoilMSARLILGRRLSRPAAKALARPRELFGESIPELLLVTAVVAAVVSG
Ga0364931_0253816_16_1803300034176SedimentMTTRVTRGRRPARPATDVLAGPRELFGESLPELLLFAAVVAAVVSAVLALNGAG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.