| Basic Information | |
|---|---|
| Taxon OID | 3300003979 Open in IMG/M |
| Scaffold ID | Ga0063037_100280 Open in IMG/M |
| Source Dataset Name | Diffuse hydrothermal vent microbial communities from Menez Gwen hydrothermal field, Mid Atlantic ridge - MGW_B |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Max Planck Institute for Plant Breeding Research |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 23547 |
| Total Scaffold Genes | 22 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 16 (72.73%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Vent → Diffuse Hydrothermal Vent Microbial Communities From Menez Gwen Hydrothermal Field, Mid Atlantic Ridge |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mid-Atlantic Ridge | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F041257 | Metagenome / Metatranscriptome | 160 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0063037_10028017 | F041257 | N/A | MQEFKPNYRPLGSEEDDVVDPRSEQPDGPFDHERFKTLTVLAHAAGQVMDRYAIKGFEGFTNRQANWACKLQSFFNLSNPFETLVLLLFTFQFSRNERFDLEMGKTEPIDRSHPLSKALMAWVWWDPSSEASRVDRFYPWEYGKERTSRMVAIASGLLPEPIDVTSSGDIPPSPPRTQ* |
| ⦗Top⦘ |