NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0064346_10074326

Scaffold Ga0064346_10074326


Overview

Basic Information
Taxon OID3300003977 Open in IMG/M
Scaffold IDGa0064346_10074326 Open in IMG/M
Source Dataset NameDCM
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center454 Life Sciences
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)502
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Haptista(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Deep Chlorophyll Maximum

Source Dataset Sampling Location
Location Namespain
CoordinatesLat. (o)38.06851Long. (o)-0.23199Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030973Metagenome / Metatranscriptome183Y

Sequences

Protein IDFamilyRBSSequence
Ga0064346_100743261F030973GAGGMYQKRMQGEWNAGMLGSRNYSAVRLSEGRHWKGNLYGTTINDQHQGHRNYDCPHIFSKGPEPKFENMDHAMKHKSVYLGFYGN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.