| Basic Information | |
|---|---|
| Taxon OID | 3300003977 Open in IMG/M |
| Scaffold ID | Ga0064346_10004849 Open in IMG/M |
| Source Dataset Name | DCM |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | 454 Life Sciences |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 534 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Deep Chlorophyll Maximum |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | spain | |||||||
| Coordinates | Lat. (o) | 38.06851 | Long. (o) | -0.23199 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F046986 | Metagenome | 150 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0064346_100048491 | F046986 | N/A | KMSARFNISIRTGHDDYKRAMQLLREEQQGTREELLNQLQALRLATVQRALKRGHYQTVATLLGDMGRVIGEAAPEQLALQVPTLDIRIENENQSQ* |
| ⦗Top⦘ |