NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0064219_11863

Scaffold Ga0064219_11863


Overview

Basic Information
Taxon OID3300003976 Open in IMG/M
Scaffold IDGa0064219_11863 Open in IMG/M
Source Dataset NameSoil microbial communities from Barrow, Alaska NGEE-2011
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterYale School of Medicine
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1169
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Ngee-Artic Barrow Site, Alaska, Usa

Source Dataset Sampling Location
Location NameBarrow, Alaska
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F071789Metagenome122Y

Sequences

Protein IDFamilyRBSSequence
Ga0064219_118632F071789N/AMRRLLCVALFLATSIGIIVLPAAADTSSGKVLLSFDYSDNSAPASVSNGSFNVIVDVLPGDSTGLVRMFAVAPASTNASSIVCHFQWINQSQAECAFNFPDNGVWAIHAQYVLGPQTDVVGVAVTNLRVLN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.