Scaffold Ga0064067_1128086

Overview

Basic Information

• Taxon OID: 3300003972
• Scaffold ID: Ga0064067_1128086
• Source Dataset Name: Composted filter cake microbial communities from Nova Europa, Brazil, from a cane sugar milling plant
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Sao Paulo State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 601
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Filter Cake Produced In Cane Sugar Milling Plant → Composted Filter Cake Microbial Communities From Nova Europa, Brazil, From A Cane Sugar Milling Plant

Source Dataset Sampling Location

• Location Name: Nova Europa, Brazil
• Coordinates
  • Lat. (^o): -21.818963
  • Long. (^o): -48.614275
  • Depth (m): .2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007999	Metagenome	341	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0064067_11280861	F007999	N/A	MDPTHQRGLKARENLVNALRECGELADAVEDFDGAELLEVLDYLDSLRFVMAESGQLLAGVVRGEMSR*