| Basic Information | |
|---|---|
| Taxon OID | 3300003972 Open in IMG/M |
| Scaffold ID | Ga0064067_1108496 Open in IMG/M |
| Source Dataset Name | Composted filter cake microbial communities from Nova Europa, Brazil, from a cane sugar milling plant |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Sao Paulo State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1453 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter agaridevorans | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Filter Cake Produced In Cane Sugar Milling Plant → Composted Filter Cake Microbial Communities From Nova Europa, Brazil, From A Cane Sugar Milling Plant |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Nova Europa, Brazil | |||||||
| Coordinates | Lat. (o) | -21.818963 | Long. (o) | -48.614275 | Alt. (m) | Depth (m) | .2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006009 | Metagenome / Metatranscriptome | 384 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0064067_11084962 | F006009 | GGAGG | MTHGEQKALWRGVAAGTMVGLAIGGMIALVIATKPGFFAALLQ* |
| ⦗Top⦘ |