Basic Information | |
---|---|
Taxon OID | 3300003962 Open in IMG/M |
Scaffold ID | Ga0064068_104797 Open in IMG/M |
Source Dataset Name | Activated sludge microbial communities from Ingolstadt, Germany, from a nitrification basin |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Aalborg University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 7141 |
Total Scaffold Genes | 19 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 14 (73.68%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater → Activated Sludge Microbial Communities From Ingolstadt, Germany, From A Nitrification Basin |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Ingolstadt, Germany | |||||||
Coordinates | Lat. (o) | 48.7 | Long. (o) | 11.42 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F008501 | Metagenome | 332 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0064068_1047975 | F008501 | AGGAGG | MEMQYKKSAVDLTDLALGIVVLGIVVSVGATILVNVRDTNDADTVSYNLADDAATGLAEYGNWFKIIVIVGVAAVILALIFLAFGRGAGSVGSTY* |
⦗Top⦘ |