Scaffold Ga0064068_100296

Overview

Basic Information

• Taxon OID: 3300003962
• Scaffold ID: Ga0064068_100296
• Source Dataset Name: Activated sludge microbial communities from Ingolstadt, Germany, from a nitrification basin
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Aalborg University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 114784
• Total Scaffold Genes: 157
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 29 (18.47%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales (Source: IMG-VR)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater → Activated Sludge Microbial Communities From Ingolstadt, Germany, From A Nitrification Basin

Source Dataset Sampling Location

• Location Name: Ingolstadt, Germany
• Coordinates
  • Lat. (^o): 48.7
  • Long. (^o): 11.42

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050362	Metagenome / Metatranscriptome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0064068_10029653	F050362	N/A	MGLLDKLTTQGGSPLSYGNGSTPSVNPGATQLSKLHTDGNQPGYSINGSNFTDVNTAFQQYNDGVNNVLPQPSQLDLNGATPTQYINNLPQ*