| Basic Information | |
|---|---|
| Taxon OID | 3300003950 Open in IMG/M |
| Scaffold ID | Ga0064032_10577 Open in IMG/M |
| Source Dataset Name | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS907_80_13H6 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Marine Biological Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 770 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Anemone diffuse flow vent, Axial seamount | |||||||
| Coordinates | Lat. (o) | 45.933 | Long. (o) | -130.014 | Alt. (m) | Depth (m) | 1542 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051069 | Metagenome / Metatranscriptome | 144 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0064032_105772 | F051069 | GAGG | MAYRVSISSTELVTRAEVVAYAKIENTDENSIIDALITSSREELEKLLKIPLITQVLAQTYDSFIEPVYAPMIPLTSAALEIADSDGNFSANTYISVKKDTGRIAPTDVFSPSLQFDGFKITFTYTVSAIDAALKTAIMELTSYRFYNRGNLEAAKIPASVLSMVGHLRVFSV* |
| ⦗Top⦘ |