Scaffold Ga0063391_1005448

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0063391_1005448

Scaffold Ga0063391_1005448

Overview

Basic Information
Taxon OID	3300003937 Open in IMG/M
Scaffold ID	Ga0063391_1005448 Open in IMG/M
Source Dataset Name	SPOT_150m_metagenome_year
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of California, Davis
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	20779
Total Scaffold Genes	30 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	24 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From The San Pedro Channel, Pacific Ocean In The San Pedro Ocean Time-Series (Spot) Study

Source Dataset Sampling Location
Location Name	San Pedro Channel, Pacific
Coordinates	Lat. (^o)	33.55	Long. (^o)	-118.42	Alt. (m)		Depth (m)	890
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072758	Metagenome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0063391_10054483	F072758	GAGG	MDELYEEYEKLTINHEPLMAAGIMMAQAMKIYKAMLSEDEFKLMTEHILKSRDDIPTSEIPKVH*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.