NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0063391_1002441

Scaffold Ga0063391_1002441


Overview

Basic Information
Taxon OID3300003937 Open in IMG/M
Scaffold IDGa0063391_1002441 Open in IMG/M
Source Dataset NameSPOT_150m_metagenome_year
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of California, Davis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)32051
Total Scaffold Genes38 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (26.32%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From The San Pedro Channel, Pacific Ocean In The San Pedro Ocean Time-Series (Spot) Study

Source Dataset Sampling Location
Location NameSan Pedro Channel, Pacific
CoordinatesLat. (o)33.55Long. (o)-118.42Alt. (m)Depth (m)890
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002549Metagenome / Metatranscriptome549Y
F104911Metagenome / Metatranscriptome100N

Sequences

Protein IDFamilyRBSSequence
Ga0063391_100244116F002549N/AMSKLLKLLGGSAAPLLDKAAEVADRFIDTPAEKKAFIKEAYQQEVLDRKEARELGKNKSTPDILTYVTLFIAIGLATAIFTDFLNWETLTEVQKGLITTFSGFFLRTLGDVYGYWFGSSMGSGDKTKDLTKLMRK*
Ga0063391_10024412F104911GAGMKTPINFQDYLNFRKDQVAHDMFRVLYNDLSHNGQNEIDDEVGTEFIKIFNLLYNS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.