NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F104911

Metagenome / Metatranscriptome Family F104911

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F104911
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 61 residues
Representative Sequence MKTPINFQDYLNFRKDQVAHDMYRVLYNDLSATGKDEIDDEVATEFIKVFNLLYIQE
Number of Associated Samples 91
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 38.00 %
% of genes near scaffold ends (potentially truncated) 48.00 %
% of genes from short scaffolds (< 2000 bps) 88.00 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (56.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(22.000 % of family members)
Environment Ontology (ENVO) Unclassified
(74.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(87.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 71.93%    β-sheet: 0.00%    Coil/Unstructured: 28.07%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF00166Cpn10 1.00
PF08279HTH_11 1.00
PF08299Bac_DnaA_C 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 1.00
COG0593Chromosomal replication initiation ATPase DnaAReplication, recombination and repair [L] 1.00


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms73.00 %
UnclassifiedrootN/A27.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001344|JGI20152J14361_10037293All Organisms → Viruses → Predicted Viral1472Open in IMG/M
3300001348|JGI20154J14316_10022297All Organisms → cellular organisms → Bacteria3443Open in IMG/M
3300001351|JGI20153J14318_10026284All Organisms → cellular organisms → Bacteria2614Open in IMG/M
3300003592|JGI26246J51724_1096885All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300003937|Ga0063391_1002441Not Available32051Open in IMG/M
3300005732|Ga0076920_128564All Organisms → cellular organisms → Bacteria1262Open in IMG/M
3300005828|Ga0074475_11016677All Organisms → cellular organisms → Bacteria980Open in IMG/M
3300006029|Ga0075466_1094524All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300006789|Ga0098054_1111888All Organisms → Viruses → Predicted Viral1019Open in IMG/M
3300006793|Ga0098055_1138832All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300006793|Ga0098055_1246783All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300006802|Ga0070749_10042458All Organisms → Viruses → Predicted Viral2793Open in IMG/M
3300006803|Ga0075467_10391985All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300006810|Ga0070754_10400950Not Available600Open in IMG/M
3300006869|Ga0075477_10243217All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300006874|Ga0075475_10064094All Organisms → cellular organisms → Bacteria1708Open in IMG/M
3300006919|Ga0070746_10409472All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300006922|Ga0098045_1086342All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300006924|Ga0098051_1002570All Organisms → cellular organisms → Bacteria6352Open in IMG/M
3300006925|Ga0098050_1003145All Organisms → cellular organisms → Bacteria5427Open in IMG/M
3300007345|Ga0070752_1086509All Organisms → Viruses → Predicted Viral1362Open in IMG/M
3300007538|Ga0099851_1330253Not Available534Open in IMG/M
3300008999|Ga0102816_1112440All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300009000|Ga0102960_1106893All Organisms → Viruses → Predicted Viral1017Open in IMG/M
3300009001|Ga0102963_1112557All Organisms → cellular organisms → Bacteria1106Open in IMG/M
3300009026|Ga0102829_1075948All Organisms → Viruses → Predicted Viral1030Open in IMG/M
3300009074|Ga0115549_1273833Not Available534Open in IMG/M
3300009076|Ga0115550_1249347Not Available582Open in IMG/M
3300009086|Ga0102812_10129346All Organisms → Viruses → Predicted Viral1384Open in IMG/M
3300009423|Ga0115548_1247125Not Available548Open in IMG/M
3300009434|Ga0115562_1082669All Organisms → cellular organisms → Bacteria1314Open in IMG/M
3300009442|Ga0115563_1145873All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300009505|Ga0115564_10437298All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300010150|Ga0098056_1103133All Organisms → cellular organisms → Bacteria973Open in IMG/M
3300010150|Ga0098056_1260812Not Available574Open in IMG/M
3300010155|Ga0098047_10379701Not Available530Open in IMG/M
3300012969|Ga0129332_1204591Not Available533Open in IMG/M
3300017706|Ga0181377_1027202All Organisms → Viruses → Predicted Viral1206Open in IMG/M
3300017706|Ga0181377_1059254Not Available714Open in IMG/M
3300017706|Ga0181377_1071494All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300017706|Ga0181377_1099804Not Available500Open in IMG/M
3300017724|Ga0181388_1138640All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300017733|Ga0181426_1097963All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300017735|Ga0181431_1112932All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300017744|Ga0181397_1081121Not Available865Open in IMG/M
3300017748|Ga0181393_1087664All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300017751|Ga0187219_1042863All Organisms → cellular organisms → Bacteria1527Open in IMG/M
3300017752|Ga0181400_1084110Not Available948Open in IMG/M
3300017753|Ga0181407_1000548Not Available12728Open in IMG/M
3300020165|Ga0206125_10017903All Organisms → cellular organisms → Bacteria4395Open in IMG/M
3300020166|Ga0206128_1062465All Organisms → Viruses → Predicted Viral1751Open in IMG/M
3300020182|Ga0206129_10242332All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300021085|Ga0206677_10041490All Organisms → Viruses → Predicted Viral2468Open in IMG/M
3300021087|Ga0206683_10435009Not Available652Open in IMG/M
3300021185|Ga0206682_10094184All Organisms → cellular organisms → Bacteria1500Open in IMG/M
3300021350|Ga0206692_1303750All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300021378|Ga0213861_10001609Not Available19813Open in IMG/M
3300021378|Ga0213861_10318293Not Available793Open in IMG/M
3300021389|Ga0213868_10125085All Organisms → Viruses → Predicted Viral1624Open in IMG/M
3300021959|Ga0222716_10133827All Organisms → Viruses → Predicted Viral1636Open in IMG/M
3300022050|Ga0196883_1036719All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300022053|Ga0212030_1006569All Organisms → cellular organisms → Bacteria1347Open in IMG/M
3300022053|Ga0212030_1055039Not Available566Open in IMG/M
3300022065|Ga0212024_1037485All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300022068|Ga0212021_1014247All Organisms → Viruses → Predicted Viral1410Open in IMG/M
3300022158|Ga0196897_1012693All Organisms → Viruses → Predicted Viral1041Open in IMG/M
3300022169|Ga0196903_1028770Not Available659Open in IMG/M
3300022169|Ga0196903_1029106Not Available655Open in IMG/M
(restricted) 3300022920|Ga0233426_10022722All Organisms → cellular organisms → Bacteria3402Open in IMG/M
(restricted) 3300023276|Ga0233410_10198246All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300023694|Ga0228683_1027741All Organisms → cellular organisms → Bacteria617Open in IMG/M
(restricted) 3300024059|Ga0255040_10271807All Organisms → cellular organisms → Bacteria705Open in IMG/M
(restricted) 3300024062|Ga0255039_10161448All Organisms → cellular organisms → Bacteria923Open in IMG/M
3300024247|Ga0228675_1016783All Organisms → cellular organisms → Bacteria1810Open in IMG/M
3300024250|Ga0228677_1046759All Organisms → cellular organisms → Bacteria821Open in IMG/M
(restricted) 3300024255|Ga0233438_10240974All Organisms → cellular organisms → Bacteria720Open in IMG/M
(restricted) 3300024259|Ga0233437_1347481All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300024267|Ga0228623_1073578All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300024293|Ga0228651_1035897All Organisms → Viruses → Predicted Viral1213Open in IMG/M
3300024294|Ga0228664_1115786All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300024328|Ga0228635_1069546Not Available877Open in IMG/M
3300024329|Ga0228631_1085033All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300024508|Ga0228663_1085899All Organisms → cellular organisms → Bacteria576Open in IMG/M
(restricted) 3300024518|Ga0255048_10660762Not Available505Open in IMG/M
(restricted) 3300024520|Ga0255047_10634151Not Available534Open in IMG/M
3300025083|Ga0208791_1046838All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300025084|Ga0208298_1021095All Organisms → cellular organisms → Bacteria1443Open in IMG/M
3300025608|Ga0209654_1032117All Organisms → cellular organisms → Bacteria1786Open in IMG/M
3300025671|Ga0208898_1016656All Organisms → cellular organisms → Bacteria3404Open in IMG/M
3300025671|Ga0208898_1114627Not Available790Open in IMG/M
3300025809|Ga0209199_1271493Not Available543Open in IMG/M
3300025887|Ga0208544_10222169All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300026504|Ga0247587_1126126All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300026506|Ga0228604_1057037All Organisms → cellular organisms → Bacteria636Open in IMG/M
(restricted) 3300027996|Ga0233413_10293375Not Available698Open in IMG/M
3300028106|Ga0247596_1056270All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300028136|Ga0228608_1138787All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300028233|Ga0256417_1049126All Organisms → Viruses → Predicted Viral1144Open in IMG/M
3300031539|Ga0307380_11059610Not Available641Open in IMG/M
3300034418|Ga0348337_076177All Organisms → Viruses → Predicted Viral1193Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous22.00%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater17.00%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine15.00%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater10.00%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater7.00%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine7.00%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater3.00%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.00%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater3.00%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine3.00%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine2.00%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water2.00%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.00%
MarineEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine1.00%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.00%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.00%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.00%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.00%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001344Pelagic Microbial community sample from North Sea - COGITO 998_met_02EnvironmentalOpen in IMG/M
3300001348Pelagic Microbial community sample from North Sea - COGITO 998_met_04EnvironmentalOpen in IMG/M
3300001351Pelagic Microbial community sample from North Sea - COGITO 998_met_03EnvironmentalOpen in IMG/M
3300003592Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNAEnvironmentalOpen in IMG/M
3300003937SPOT_150m_metagenome_yearEnvironmentalOpen in IMG/M
3300005732Seawater microbial communities from Vineyard Sound, MA, USA - Succinate ammended T7EnvironmentalOpen in IMG/M
3300005828Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.182_BBIEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009000Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MGEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009074Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430EnvironmentalOpen in IMG/M
3300009076Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009423Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009505Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523EnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010155Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaGEnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017733Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020166Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1EnvironmentalOpen in IMG/M
3300020182Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021087Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300022050Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3)EnvironmentalOpen in IMG/M
3300022053Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022158Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v3)EnvironmentalOpen in IMG/M
3300022169Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022920 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MGEnvironmentalOpen in IMG/M
3300023276 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MGEnvironmentalOpen in IMG/M
3300023694Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 31R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024059 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2EnvironmentalOpen in IMG/M
3300024062 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1EnvironmentalOpen in IMG/M
3300024247Seawater microbial communities from Monterey Bay, California, United States - 36D_rEnvironmentalOpen in IMG/M
3300024250Seawater microbial communities from Monterey Bay, California, United States - 58D_rEnvironmentalOpen in IMG/M
3300024255 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MGEnvironmentalOpen in IMG/M
3300024259 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_200_MGEnvironmentalOpen in IMG/M
3300024267Seawater microbial communities from Monterey Bay, California, United States - 28DEnvironmentalOpen in IMG/M
3300024293Seawater microbial communities from Monterey Bay, California, United States - 63DEnvironmentalOpen in IMG/M
3300024294Seawater microbial communities from Monterey Bay, California, United States - 78DEnvironmentalOpen in IMG/M
3300024328Seawater microbial communities from Monterey Bay, California, United States - 44DEnvironmentalOpen in IMG/M
3300024329Seawater microbial communities from Monterey Bay, California, United States - 39DEnvironmentalOpen in IMG/M
3300024508Seawater microbial communities from Monterey Bay, California, United States - 77DEnvironmentalOpen in IMG/M
3300024518 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2EnvironmentalOpen in IMG/M
3300024520 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1EnvironmentalOpen in IMG/M
3300025083Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025608Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025809Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026504Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 46R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026506Seawater microbial communities from Monterey Bay, California, United States - 4DEnvironmentalOpen in IMG/M
3300027996 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MGEnvironmentalOpen in IMG/M
3300028106Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028136Seawater microbial communities from Monterey Bay, California, United States - 9DEnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI20152J14361_1003729363300001344Pelagic MarineMKTPINFQDYLNFRKDQVAHDMFRVLYNDLSAAGQEEVNDEVATEFIKIF
JGI20154J14316_1002229713300001348Pelagic MarineFTRLIRSEFDNISVTKREYMKTPINFQDYLNFRKDQVAHDMFRVLYNDLSAAGQEEVNDEVATEFIKIFHLLYAQE*
JGI20153J14318_1002628463300001351Pelagic MarineMKTPINFQDYLNFRKDQVAHDMFRVLYNDLSAAGQEEVNDEVATEFIKIFHLLYAQE*
JGI26246J51724_109688523300003592MarineMKTPINFQDYLNFRKDQVAHDMFRVLYSDLSANGQNEIDDEIGGEFIKIFNLLYNE*
Ga0063391_100244123300003937MarineMKTPINFQDYLNFRKDQVAHDMFRVLYNDLSHNGQNEIDDEVGTEFIKIFNLLYNS*
Ga0076920_12856413300005732MarineMKTPINFQDYLNFRKDQVAHDMFRVQYNDLLSPGQEEVNDEVATEFIKVFNLLYIQE*
Ga0074475_1101667733300005828Sediment (Intertidal)MKTPINFQDYLNFRKDQVAHDMYRVPYNDLSATGKDEINDEVATEFIKVFNLLYIQE*
Ga0075466_109452413300006029AqueousLFTNIIRSEFDNISVTKRNNMKTPINFQDYLNFRKDQVAHDMFRVQYNDLLSPGQEEVNDEVATEFIKVFNLLYIQE*
Ga0098054_111188833300006789MarineMKTPINFQDYLNFRKDQVAHDMYRVLYNDLSTTGKDEIDDEVATEFIKVFN
Ga0098055_113883233300006793MarineFTRLIRSEFDNISVTKREYMKTPINFQDYLNFRKDQVAHDMYRVLYNDLSTIGKDEIDDEVATEFIKVFNLLYIQE*
Ga0098055_124678323300006793MarineMKTPINFQDYLNFRKDQVAHDMFRVLYDDLSHNGQNEINDEVATEFIKVFNLLYNH*
Ga0070749_1004245843300006802AqueousMKTPINFQDYLNFRKDQVAHDMFRVLYNDLLSPGKDEVDDEVATEFIKVFNLLYIQE*
Ga0075467_1039198513300006803AqueousMKTPINFQDYLNFRKDQVAHDMFRVLYNDLLSPGQEEVNDEVATEFIKVFNLLYIQE*
Ga0070754_1040095013300006810AqueousMKTPINFQDYLNFRKDQVANDMFKVLYNDLSSKGKDEVDDEVATEFIKVFNLLYIQE*
Ga0075477_1024321713300006869AqueousNNMKTPINFQDYLNFRKDQVANDMFRVQYNDLLSPGQEEVNDEVATEFIKVFNLLYIQE*
Ga0075475_1006409413300006874AqueousISVTKRNNMKTPINFQDYLNFRKDQVAHDMFRVLYNDLLSPGKDEVDDEVATEFIKVFNLLYIQE*
Ga0070746_1040947223300006919AqueousNISVTKRNNMKTPINFQDYLNFRKDQVAHDMFRVLYNDLLSPGQEEVNDEVATEFIKVFNLLYIQE*
Ga0098045_108634213300006922MarineFTRLIRSEFDNISVTKREYMKTPINFQDYLNFRKDQVAHDMYRVLYNDLSTTGKDEIDDEVATEFIKVFNLLYIQE*
Ga0098051_100257053300006924MarineMKTPINFQDYLNFRKDQVAHDMYRVLYNDLSTTGKDEIDDEVATEFIKVFNLLYIQE*
Ga0098050_100314533300006925MarineMKTPINFQDYLNFRKDQVAHDMYRVVYNDLSTTAKDEIDDEVATEFIKVFNLLYIQE*
Ga0070752_108650913300007345AqueousMKTPINFQDYLTFRKDQVANDMFKVQYNDLSSMGQEEVNDEVATEFIKVFNLLYIQE*
Ga0099851_133025323300007538AqueousNNMKTPINFQDYLNFRKDQVAHDMFRVLYNDLLSPGKEEVNDEVATEFIKVFNLLYIQE*
Ga0102816_111244023300008999EstuarineMKTPINFQDYLNFRKDQVAHDMFRVLYSDLSANGQNEIDDEIGGEFIKIFNLLYNS*
Ga0102960_110689343300009000Pond WaterMKTPINFQDYLNFRKDQVAHDMYRVLYNDLSAIGRNEIDDEVATEFIKIFNLLYIQE*
Ga0102963_111255733300009001Pond WaterMKTPINFQDYLEFRKDQVAHDMYRVLYNDLSHTGQDEINDEVGSEFIKIFNLLYNS*
Ga0102829_107594823300009026EstuarineMKTPINFQDYLNFRKDQVAHDMFRVLYSDLSANGQNEIDDEVGTEFIKIFNLLYNS*
Ga0115549_127383323300009074Pelagic MarineIRSEFDNISVTKREYMKTPINFQDYLNFRKDQVANDMFRVQYNDLLSPGQEEVNDEVATEFIKVFNLLYIQE*
Ga0115550_124934713300009076Pelagic MarineMKTPINFQDYLNFRKDQVANDMFRVQYNDLLSPGQEEVNDEVATEFIKVFNLLYIQE*
Ga0102812_1012934633300009086EstuarineMKTPINFQDYLNFRKDQVAHDMYRVLYSDLSTNGQNEIDDEIGDEYIKIFNLLYNE*
Ga0115548_124712513300009423Pelagic MarineRLIRSEFDNISVTKREYMKTPINFQDYLNFRKDQVANDMFRVQYNDLLSPGQEEVNDEVATEFIKVFNLLYIQE*
Ga0115562_108266943300009434Pelagic MarineLYSFTRLIRSEFDNISVTKREYMKTPINFQDYLNFRKDQVANDMFRVQYNDLLSPGQEEVNDEVATEFIKVFNLLYIQE*
Ga0115563_114587313300009442Pelagic MarineSYSFTRLIRSEFDNISVTKREYMKTPINFQDYLNFRKDQVANDMFRVQYNDLLSPGQEEVNDEVATEFIKVFNLLYIQE*
Ga0115564_1043729813300009505Pelagic MarineYSFTRLIRSEFDNISVTKREYMKTPINFQDYLNFRKDQVANDMFRVQYNDLLSPGQEEVNDEVATEFIKVFNLLYIQE*
Ga0098056_110313333300010150MarineLIRSEFDNISVTKREYMKTPINFQDYLNFRKDQVAHDMYRVLYNDLSTTGKDEIDDEVATEFIKVFNLLYIQD*
Ga0098056_126081223300010150MarineLIRSEFDNISVTKREYMKTPINFQDYLNFRKDQVAHDMYRVVYNDLSTTAKDEIDDEVATEFIKVFNLLYIQE*
Ga0098047_1037970113300010155MarineMKTPINFQDYLNFRKDQVAHDMYRVVYNDLSTTAKDEIDDEVATEFIKVFN
Ga0129332_120459113300012969AqueousPINFQDYLNFRKDQVAHDMYRVLYNDLSAIGRNEIDDEVATEFIKIFNLLYIQE*
Ga0181377_102720243300017706MarineMKTPINFQDYLNFRKDQVAHDMFRVLYNDLSVNGKNEIDDEVGTEFIKIFNLLYNS
Ga0181377_105925423300017706MarineMKTPINFQDYLNFRKDQVAHDMFRVLYSDLSANGQNEIDDEVATEFIKIFNLLYND
Ga0181377_107149413300017706MarineISVTKREYMKTPINFQDYLNFRKDQVAHDMYRVLYNDLSTTGKDEIDDEVATEFIKVFNLLYIQE
Ga0181377_109980413300017706MarineISVTKREYMKTPINFQDYLNFRKDQVAHDMYRVLYNDLSTIGKDEIDDEVATEFIKVFNLLYIQD
Ga0181388_113864013300017724SeawaterSFDNISVTKREYMKTPINFQDYLNFRKDQVAHDMFRVLYSDLSANGQNEIDDEVGTEFIKIFNLLYNS
Ga0181426_109796313300017733SeawaterREYMKTPINFQDYLNFRKDQVAHDMFRVLYSDLSANGQNEIDDEVGTEFIKIFNLLYNS
Ga0181431_111293223300017735SeawaterFRLTRLIRGEFDNISVTKREYMKTPINFQDYLNFRKDQVAHDMFRVLYSDLSANGQNEIDDEVGTEFIKIFNLLYNS
Ga0181397_108112133300017744SeawaterMKTPINFQDYLNFRKDQVAHDMYRVVYNDLSAAGKDEIDDEVATEFIKVFNLLYIQE
Ga0181393_108766423300017748SeawaterMKTPINFQDYLNFRKDQVAHDMYRVLYNDLSATGKDEIDDEVATEFIKVFNLLYIQE
Ga0187219_104286313300017751SeawaterFKYLGKYTHQFFTNIIRSEFDIISVTIREYMKTPINFQDYLNFRKDQVAHDMYRVLYNDLSTTGKDEIDDEVATEFIKVFNLLYIQE
Ga0181400_108411033300017752SeawaterMKTPINFQDYLNFRKDQVAHDMYRVVYNDLSATGKDEIDDEVATEFIKIFNLLYIQE
Ga0181407_1000548343300017753SeawaterFDNISVTKREYMKTPINFQDYLNFRKDQVAHDMFRVLYSDLSANGQNEIDDEIGGEFIKIFNLLYNS
Ga0206125_1001790353300020165SeawaterMKTPINFQDYLNFRKDQVAHDMFRVLYNDLSAAGQEEVNDEVATEFIKIFHLLYAQE
Ga0206128_106246533300020166SeawaterMKTPINFQDYLNFRKDQVAHDMYRVLYNDLSAIGKNEIDDEVATEFIKIFNLLYIQE
Ga0206129_1024233213300020182SeawaterPRVIHSYSFTRLIRSEFDNISVTKREYMKTPINFQDYLNFRKDQVAHDMFRVLYNDLSAAGQEEVNDEVATEFIKIFHLLYAQE
Ga0206677_1004149053300021085SeawaterMKTPINFQDYLNFRKDQVAHDMFRVLYNDLSHNGQNEIDDEVGTEFIKIFNLLYNS
Ga0206683_1043500913300021087SeawaterMKTPINFQDYLNFRKDQVAHDMFRVLYSDLSANGQNEIDDEVGTEFIKIFNLLYNS
Ga0206682_1009418413300021185SeawaterMKTPINFQDYLNFRKDQVAHDMFRVLYSDLSANGQNEIDDEIGGEFIKIFNLLYNS
Ga0206692_130375013300021350SeawaterKTPINFQDYLNFRKDQVAHDMFRVLYNDLSHNGQNEIDDEVGTEFIKIFNLLYNS
Ga0213861_10001609203300021378SeawaterMKTPINFQDYLEFRKNQVAHDMYRVLYNDLSAIGKDEINDEVATEFIKIFNLLYNE
Ga0213861_1031829313300021378SeawaterMKTPINFQDYLNFRKDQVAHDMFRVQYNDLLSPGQEEVNDEVATEFIKVFNLLYIQE
Ga0213868_1012508533300021389SeawaterMKTPINFQDYLNFRKDQVANDMFKVLYNDLSSKGKDEVDDEVATEFIKVFNLLYIQE
Ga0222716_1013382763300021959Estuarine WaterMKTPINFQDYLNFRKDQVAHDMYRVLYNDLSAIGRNEIDDEVATEFIKIFNLLYIQE
Ga0196883_103671923300022050AqueousKNFQDYLNFRKDQVAHDMFRVLYNDLLSPGKDEVDDEVATEFIKVFNLLYIQE
Ga0212030_100656933300022053AqueousMKTPINFQDYLNFRKDQVAHDMFRVLYNDLLSPGQEEVNDEVATEFIKVFNLLYIQE
Ga0212030_105503913300022053AqueousMKTPINFQDYLNFRKDQVANDMFKVQYNDLSSMGQEEVNDEVATEFIKVFNLLYIQE
Ga0212024_103748523300022065AqueousMKTPINFQDYLNFRKDQVAHDMFRVLYNDLLSPGKDEVDDEVATEFIKVFNLLYIQE
Ga0212021_101424713300022068AqueousFDNISVTKRNNMKTPINFQDYLNFRKDQVAHDMFRVLYNDLLSPGKDEVDDEVATEFIKVFNLLYIQE
Ga0196897_101269313300022158AqueousMKTPINFQDYLNFRKDQVAHDMFRVLYNDLLSPGKDEVDDEVATEFIKVFNLLYI
Ga0196903_102877023300022169AqueousMKTPINFQDYLNFRKDQVAHDMFRVQYNDLLSPGQEEVNDEVATEFIKVFNLLYIQ
Ga0196903_102910613300022169AqueousMKTPINFQDYLTFRKDQVANDMFKVQYNDLSSMGQEEVNDEVATEFIKVFNLLYIQE
(restricted) Ga0233426_1002272253300022920SeawaterMKTPINFQDYLYFRKDQVANDMFKVVYNDLSSMAQENVNDEVATEFIKIFNLLYIQE
(restricted) Ga0233410_1019824623300023276SeawaterMKTPINFQDYLNFRKDQVAHDMFRVLYSDLSANGQNEIDDEVGGEFIKIFNLLYNE
Ga0228683_102774113300023694SeawaterKTPINFQDYLNFRKDQVAHDMYRVLYNDLSATGKDEIDDEVATEFIKVFNLLYIQE
(restricted) Ga0255040_1027180723300024059SeawaterMKTPINFQDYLEFRKDQVAHDMFRVLYNDLSSMGQESVNDEVGGEYIKIFNLLYN
(restricted) Ga0255039_1016144823300024062SeawaterMKTPINFQDYLEFRKDQVAHDMFRVLYNDLSSMGQENVNDEVGGEYIKIFNMLYN
Ga0228675_101678313300024247SeawaterGKYTHQFFTNIIRSEFDNISVTKREYMKTPINFQDYLNFRKDQVAHDMYRVLYNDLSTTGKDEIDDEVATEFIKVFNLLYIQE
Ga0228677_104675913300024250SeawaterLNFRKDQVAHDMFRVLYSDLSANGQNEIDDEVGTEFIKIFNLLYNS
(restricted) Ga0233438_1024097423300024255SeawaterMKTPINFQDYLNFRKDQVAHDMFRVLYNDLSSMGQESVNDEVGGEYIKIFNLLHN
(restricted) Ga0233437_134748123300024259SeawaterMKTPINFQDYLNFRKDQVAHDMFRVLYNDLSSMGQESVNDEVGGEYIKIFNLLYN
Ga0228623_107357813300024267SeawaterMKTPINFQDYLNFRKDQVAHDMYRVLYNDLSTTGKDEIDDEVATEFIKVFNLLYIQE
Ga0228651_103589723300024293SeawaterMKTPINFQDYLNFRKDQVAHDMYRVQYNDLSTTGKDEIDDEVATEFIKVFNLLYIQE
Ga0228664_111578623300024294SeawaterFDNISVTKREYMKTPINFQDYLNFRKDQVAHDMYRVLYNDLSTTGKDEIDDEVATEFIKVFNLLYIQE
Ga0228635_106954633300024328SeawaterMKTPINFQDYLNFRKDQVAHDMYRVLYNDLSAAGKDEIDDEVATEFIKVFNLLYIQE
Ga0228631_108503323300024329SeawaterIHSSTFTRLIRSEFDNISVTKREYMKTPINFQDYLNFRKDQVAHDMYRVLYNDLSTTGKDEIDDEVATEFIKVFNLLYIQE
Ga0228663_108589923300024508SeawaterRSEFDNISVTKREYMKTPINFQDYLNFRKDQVAHDMYRVLYNDLSATGQNEINDEVGTEFIKIFNLLYNS
(restricted) Ga0255048_1066076223300024518SeawaterMKTPINFQDYLEFRKDQVAHDMFRVLYNDLSSMGQENVNDEVGGEYIKIFNLLYN
(restricted) Ga0255047_1063415123300024520SeawaterVTKRNNMKTPINFQDYLYFRKDQVANDMFKVLYNDLSSMGQENVNDEVANEFIKIFNLLYIQE
Ga0208791_104683833300025083MarineMKTPINFQDYLNFRKDQVAHDMYRVLYNDLSTTAKDEIDDEVATEFIKVFNLLYIQE
Ga0208298_102109553300025084MarineISVTKREYMKTPINFQDYLNFRKDQVAHDMYRVLYNDLSTTAKDEIDDEVATEFIKVFNLLYIQE
Ga0209654_103211743300025608MarineMKTPINFQDYLEFRKDQVAHDMYRVLYNDLSHTGQDEINDEVGSEFIKIFNLLYNS
Ga0208898_101665643300025671AqueousMKTPINFQDYLNFRKDQVAHDMFRVLYNDLLSPGQEEVDDEVATEFIKVFNLLYIQE
Ga0208898_111462723300025671AqueousMKTPINFQDYLNFRKDQVANDMFRVQYNDLLSPGQEEVNDEVATEFIKVFNLLYIQ
Ga0209199_127149313300025809Pelagic MarineYLYSFTRLIRSEFDNISVTKREYMKTPINFQDYLNFRKDQVANDMFRVQYNDLLSPGQEEVNDEVATEFIKVFNLLYIQE
Ga0208544_1022216923300025887AqueousNFQDYLNFRKDQVAHDMFRVQYNDLLSPGQEEVNDEVATEFIKVFNLLYIQE
Ga0247587_112612613300026504SeawaterYMKTPINFQDYLNFRKDQVAHDMYRVVYNDLSAAGKDEIDDEVATEFIKVFNLLYIQE
Ga0228604_105703713300026506SeawaterMKTTINFQDYLNFRKDQVAHDMYRVLYNDLSTTGKDEIDDEVATEFIKVFNLLYIQE
(restricted) Ga0233413_1029337513300027996SeawaterMKTPINFQDYLNFRKDQVAHDMFRVLYSDLSANGQNEIDDEIGGEFIKIFNLLYNE
Ga0247596_105627013300028106SeawaterPINFQDYLNFRKDQVAHDMFRVLYSDLSANGQNEIDDEVGTEFIKIFNLLYNS
Ga0228608_113878723300028136SeawaterSEFDNISVTKREYMKTPINFQDYLNFRKDQVAHDMFRVLYSDLSANGQNEIDDEVGTEFIKIFNLLYNS
Ga0256417_104912633300028233SeawaterKTPINFQDYLNFRKDQVAHDMFRVLYSDLSANGQNEIDDEVGTEFIKIFNLLYNS
Ga0307380_1105961023300031539SoilMKTPINFQDYLTFRKDQVANDMFKVLYNDLSSLGKDEVNDEVATEFIKVFNLLYIQE
Ga0348337_076177_3_1613300034418AqueousMKTPINFQDYLNFRKDQVAHDMFRVLYNDLLSPGKDEVDDEVATEFIKVFNLL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.