Scaffold Ga0063012_10087053

Overview

Basic Information

• Taxon OID: 3300003892
• Scaffold ID: Ga0063012_10087053
• Source Dataset Name: Hot spring sediment microbial communities from Chocolate Pots, Yellowstone National Park, Wyoming that are Fe(III) reducing - CP Core 2, 1cm
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Wisconsin, Madison
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 514
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Sediment → Hot Spring Sediment Microbial Communities From Chocolate Pots, Yellowstone National Park, Wyoming That Are Fe(Iii) Reducing

Source Dataset Sampling Location

• Location Name: Chocolate Pots Hot Spring, Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.427936
  • Long. (^o): -110.588466
  • Depth (m): .01

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068552	Metagenome / Metatranscriptome	124	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0063012_100870531	F068552	N/A	DRALVVDPEGISFVLGQIKKTVPQAASAKPEDFFDPRFFTELQKSGFLKSLWGEH*