| Basic Information | |
|---|---|
| Taxon OID | 3300003889 Open in IMG/M |
| Scaffold ID | Ga0062441_1033183 Open in IMG/M |
| Source Dataset Name | Freshwater pond sediment microbial communities from Middleton WI, enriched with Humin and Glucose under anaerobic conditions - HM Sample 1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Wisconsin |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4366 |
| Total Scaffold Genes | 10 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (20.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Sediment → Unclassified → Anaerobic Enrichment Culture → Freshwater Pond Sediment Microbial Communities From Middleton Wi, Enriched By Humin And/Or Glucose Under Anaerobic Conditions |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Middleton, WI | |||||||
| Coordinates | Lat. (o) | 43.0603 | Long. (o) | -89.5717 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F088758 | Metagenome | 109 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0062441_10331835 | F088758 | AGGA | MRWLAIDIGEWEEIRQCPECGAAWLATWPEESEAPPVFCRPKPLGTRXRKLRDLDHAATLRPYCLARLEEQLGELKERKADCRKVNCSRHRLAGSTYCLEHLIAERFGKDLAKLG* |
| ⦗Top⦘ |