| Basic Information | |
|---|---|
| Taxon OID | 3300003887 Open in IMG/M |
| Scaffold ID | Ga0062443_1031984 Open in IMG/M |
| Source Dataset Name | Freshwater pond sediment microbial communities from Middleton WI, HM 5/6 enriched by Humin under anaerobic conditions -HM Sample 3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Wisconsin, Madison |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2538 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (14.29%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Sediment → Unclassified → Anaerobic Enrichment Culture → Freshwater Pond Sediment Microbial Communities From Middleton Wi, Enriched By Humin And/Or Glucose Under Anaerobic Conditions |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Middleton, WI | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009620 | Metagenome / Metatranscriptome | 315 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0062443_10319842 | F009620 | N/A | VVMALEAWDKFATPGEKFDETEAPSEALDRREMIVLMGESHSGQKQKFLPIICSGNGKFFGFGESEAPTMDXXXXXXXXXXXXXAQLLPTKVPDAAMRDLALTMLKVKGVGSATPGAIPRLHRNRR* |
| ⦗Top⦘ |