Scaffold Ga0062443_1023043

Overview

Basic Information

• Taxon OID: 3300003887
• Scaffold ID: Ga0062443_1023043
• Source Dataset Name: Freshwater pond sediment microbial communities from Middleton WI, HM 5/6 enriched by Humin under anaerobic conditions -HM Sample 3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Wisconsin, Madison
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 19513
• Total Scaffold Genes: 23
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 17 (73.91%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Anaerobic Enrichment Culture → Freshwater Pond Sediment Microbial Communities From Middleton Wi, Enriched By Humin And/Or Glucose Under Anaerobic Conditions

Source Dataset Sampling Location

• Location Name: Middleton, WI
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090578	Metagenome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0062443_10230432	F090578	N/A	MDRCRGASPVLIANAMWDTNPWAPWGLIHVVRDGVATVTETGLWFLLQRHPDAVEADGKGYWLYLDQPYRAERAGDRAFFKLMPAPSRRRGG*