Scaffold Ga0062443_1007495

Overview

Basic Information

• Taxon OID: 3300003887
• Scaffold ID: Ga0062443_1007495
• Source Dataset Name: Freshwater pond sediment microbial communities from Middleton WI, HM 5/6 enriched by Humin under anaerobic conditions -HM Sample 3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Wisconsin, Madison
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 28790
• Total Scaffold Genes: 25
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 22 (88.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Anaerobic Enrichment Culture → Freshwater Pond Sediment Microbial Communities From Middleton Wi, Enriched By Humin And/Or Glucose Under Anaerobic Conditions

Source Dataset Sampling Location

• Location Name: Middleton, WI
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079531	Metagenome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0062443_100749516	F079531	GGAG	MRTWIRMAVLAVTLAFAAPAAAQYTFTQPGMQPQPVQQLQLWNNVARVNLGVSFFNSGYYNCNYWYGYYPTYTCGSGSFVSYIPFTVGPQVDFNLGGMNNISVGFNVFLGTATGTLYSGNLSQSVSKSVTIWEPTIDYVAKFGPPSQDTVGRFRVGGGMYIGPNSELGGAFRIGGGASFLNSNRLGIGLDLVLEGGGYNGYWIGGLQLVASPEFHF*