NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0063276_10236077

Scaffold Ga0063276_10236077


Overview

Basic Information
Taxon OID3300003883 Open in IMG/M
Scaffold IDGa0063276_10236077 Open in IMG/M
Source Dataset NamePlastic marine debris microbial communities from the Atlantic Ocean - SEA_0035_20120519_metagen
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMarine Biological Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)750
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Plastic Marine Debris Microbial Communities From The Atlantic Ocean

Source Dataset Sampling Location
Location NameAtlantic Ocean
CoordinatesLat. (o)27.32333Long. (o)-63.565Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007917Metagenome / Metatranscriptome342Y

Sequences

Protein IDFamilyRBSSequence
Ga0063276_102360772F007917N/AMSKDDIVCLLMILNVNTYANVILERSLRANEGHIGVNESIMTVMKQIWTQMNVYFA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.