Basic Information | |
---|---|
IMG/M Taxon OID | 3300003883 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0113941 | Gp0109638 | Ga0063276 |
Sample Name | Plastic marine debris microbial communities from the Atlantic Ocean - SEA_0035_20120519_metagen |
Sequencing Status | Permanent Draft |
Sequencing Center | Marine Biological Laboratory |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 342333549 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 1 |
Not Available | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Plastic Marine Debris Microbial Communities From The Atlantic Ocean |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Plastic Marine Debris Microbial Communities From The Atlantic Ocean |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | marine biome → marine water body → manufactured plastic |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Surface (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Atlantic Ocean | |||||||
Coordinates | Lat. (o) | 27.32333 | Long. (o) | -63.565 | Alt. (m) | N/A | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F007917 | Metagenome / Metatranscriptome | 342 | Y |
F034767 | Metagenome / Metatranscriptome | 174 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0063276_10178797 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 1280 | Open in IMG/M |
Ga0063276_10236077 | Not Available | 750 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0063276_10178797 | Ga0063276_101787972 | F034767 | MAFGSKIVGVTYDILRGVNATVWGGVEGAEKVEKIVKTGISGADIVIGTSHALEDFGCNDVVCGTIDVAGSVSSAVGLVLGNIPTTKHLTFITGSVTVGCRSVRYYCKRYGTFWGCTVAAGQGIKEAIKFSIKQ* |
Ga0063276_10236077 | Ga0063276_102360772 | F007917 | MSKDDIVCLLMILNVNTYANVILERSLRANEGHIGVNESIMTVMKQIWTQMNVYFA* |
⦗Top⦘ |