NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003883

3300003883: Plastic marine debris microbial communities from the Atlantic Ocean - SEA_0035_20120519_metagen



Overview

Basic Information
IMG/M Taxon OID3300003883 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0113941 | Gp0109638 | Ga0063276
Sample NamePlastic marine debris microbial communities from the Atlantic Ocean - SEA_0035_20120519_metagen
Sequencing StatusPermanent Draft
Sequencing CenterMarine Biological Laboratory
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size342333549
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NamePlastic Marine Debris Microbial Communities From The Atlantic Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Plastic Marine Debris Microbial Communities From The Atlantic Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodymanufactured plastic
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Surface (saline)

Location Information
LocationAtlantic Ocean
CoordinatesLat. (o)27.32333Long. (o)-63.565Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007917Metagenome / Metatranscriptome342Y
F034767Metagenome / Metatranscriptome174Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0063276_10178797All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1280Open in IMG/M
Ga0063276_10236077Not Available750Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0063276_10178797Ga0063276_101787972F034767MAFGSKIVGVTYDILRGVNATVWGGVEGAEKVEKIVKTGISGADIVIGTSHALEDFGCNDVVCGTIDVAGSVSSAVGLVLGNIPTTKHLTFITGSVTVGCRSVRYYCKRYGTFWGCTVAAGQGIKEAIKFSIKQ*
Ga0063276_10236077Ga0063276_102360772F007917MSKDDIVCLLMILNVNTYANVILERSLRANEGHIGVNESIMTVMKQIWTQMNVYFA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.