Basic Information | |
---|---|
Taxon OID | 3300003874 Open in IMG/M |
Scaffold ID | Ga0062457_1034209 Open in IMG/M |
Source Dataset Name | Isolated Sinkhole microbial communities from Lake Huron, MI - Assembly 2014 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Michigan |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 597 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Suessiaceae → Polarella → Polarella glacialis | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Sediment And Microbial Mat → Isolated Sinkhole Microbial Communities From Lake Huron, Mi |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lake Huron, Mi | |||||||
Coordinates | Lat. (o) | 45.2166667 | Long. (o) | -83.15 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F018020 | Metagenome / Metatranscriptome | 237 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0062457_10342092 | F018020 | N/A | DTLGDGKTEKVSMILSGYSSLTLEMRSVPIPDPVPPPIE* |
⦗Top⦘ |