Scaffold Ga0062457_1034209

Overview

Basic Information

• Taxon OID: 3300003874
• Scaffold ID: Ga0062457_1034209
• Source Dataset Name: Isolated Sinkhole microbial communities from Lake Huron, MI - Assembly 2014
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Michigan
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 597
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Suessiaceae → Polarella → Polarella glacialis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Sediment And Microbial Mat → Isolated Sinkhole Microbial Communities From Lake Huron, Mi

Source Dataset Sampling Location

• Location Name: Lake Huron, Mi
• Coordinates
  • Lat. (^o): 45.2166667
  • Long. (^o): -83.15

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018020	Metagenome / Metatranscriptome	237	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0062457_10342092	F018020	N/A	DTLGDGKTEKVSMILSGYSSLTLEMRSVPIPDPVPPPIE*