| Basic Information | |
|---|---|
| Taxon OID | 3300003874 Open in IMG/M |
| Scaffold ID | Ga0062457_1034209 Open in IMG/M |
| Source Dataset Name | Isolated Sinkhole microbial communities from Lake Huron, MI - Assembly 2014 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Michigan |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 597 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Suessiaceae → Polarella → Polarella glacialis | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Sediment And Microbial Mat → Isolated Sinkhole Microbial Communities From Lake Huron, Mi |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Huron, Mi | |||||||
| Coordinates | Lat. (o) | 45.2166667 | Long. (o) | -83.15 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F018020 | Metagenome / Metatranscriptome | 237 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0062457_10342092 | F018020 | N/A | DTLGDGKTEKVSMILSGYSSLTLEMRSVPIPDPVPPPIE* |
| ⦗Top⦘ |