3300003874: Isolated Sinkhole microbial communities from Lake Huron, MI - Assembly 2014

Overview

Basic Information

• IMG/M Taxon OID: 3300003874
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0113835 | Gp0109374 | Ga0062457
• Sample Name: Isolated Sinkhole microbial communities from Lake Huron, MI - Assembly 2014
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Michigan
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 84473367
• Sequencing Scaffolds: 1
• Novel Protein Genes: 3
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Suessiaceae → Polarella → Polarella glacialis	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Isolated Sinkhole Microbial Communities From Lake Huron, Mi
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Sediment And Microbial Mat → Isolated Sinkhole Microbial Communities From Lake Huron, Mi

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater biome → sinkhole → microbial mat material
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: Lake Huron, Mi
• Coordinates
  • Lat. (^o): 45.2166667
  • Long. (^o): -83.15
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000211	Metagenome / Metatranscriptome	1583	Y
F018020	Metagenome / Metatranscriptome	237	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0062457_1034209	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Suessiaceae → Polarella → Polarella glacialis	597

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0062457_1034209	Ga0062457_10342092	F018020	DTLGDGKTEKVSMILSGYSSLTLEMRSVPIPDPVPPPIE*
Ga0062457_1040197	Ga0062457_10401971	F000211	MSYIYKVFEHLEQLWMGIWQPTHTVTTTEVSPDLGELAEILDDVSVEMIPLRYR*
Ga0062457_1040197	Ga0062457_10401972	F000211	MSYIYKVFEHLKQLWMGIWQHIHTATTTEVSPDLGEFADILDDVSVEMIPLRYR*