Basic Information | |
---|---|
Taxon OID | 3300003830 Open in IMG/M |
Scaffold ID | Ga0051980_10129618 Open in IMG/M |
Source Dataset Name | Groundwater microbial communities from aquifer in Utah, USA - Crystal Geyser 4/9/14 3 um filter |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1413 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Development Of A Pipeline For High-Throughput Recovery Of Near-Complete And Complete Microbial Genomes From Complex Metagenomic Datasets |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Utah | |||||||
Coordinates | Lat. (o) | 38.9383 | Long. (o) | -110.1342 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F080204 | Metagenome | 115 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0051980_101296182 | F080204 | N/A | MKGVDRIGRTDPKKKISSFSISYKSLCTTFPQLWINEIKDKEGKN* |
⦗Top⦘ |