| Basic Information | |
|---|---|
| Family ID | F080204 |
| Family Type | Metagenome |
| Number of Sequences | 115 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MKGVDGTGRTDPEKKISSFSISYKSLCTMFPQLWINEIKDKEGKIFED |
| Number of Associated Samples | 75 |
| Number of Associated Scaffolds | 115 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 16.52 % |
| % of genes near scaffold ends (potentially truncated) | 33.91 % |
| % of genes from short scaffolds (< 2000 bps) | 71.30 % |
| Associated GOLD sequencing projects | 68 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.609 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland (20.870 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.217 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (35.652 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.89% β-sheet: 0.00% Coil/Unstructured: 67.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 115 Family Scaffolds |
|---|---|---|
| PF11638 | DnaA_N | 53.91 |
| PF03989 | DNA_gyraseA_C | 36.52 |
| PF00712 | DNA_pol3_beta | 2.61 |
| PF02518 | HATPase_c | 2.61 |
| PF01809 | YidD | 0.87 |
| PF02464 | CinA | 0.87 |
| PF00521 | DNA_topoisoIV | 0.87 |
| PF02768 | DNA_pol3_beta_3 | 0.87 |
| PF04608 | PgpA | 0.87 |
| COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
|---|---|---|---|
| COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 37.39 |
| COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 3.48 |
| COG0759 | Membrane-anchored protein YidD, putatitve component of membrane protein insertase Oxa1/YidC/SpoIIIJ | Cell wall/membrane/envelope biogenesis [M] | 0.87 |
| COG1267 | Phosphatidylglycerophosphatase A | Lipid transport and metabolism [I] | 0.87 |
| COG1546 | Nicotinamide mononucleotide (NMN) deamidase PncC | Coenzyme transport and metabolism [H] | 0.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.61 % |
| Unclassified | root | N/A | 17.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003830|Ga0051980_10129618 | Not Available | 1413 | Open in IMG/M |
| 3300003859|Ga0031653_10033861 | Not Available | 1419 | Open in IMG/M |
| 3300003861|Ga0031654_10126992 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300005213|Ga0068998_10189568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300005833|Ga0074472_11239011 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300006224|Ga0079037_100364568 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300006224|Ga0079037_102520254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300007986|Ga0100380_10357533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 694 | Open in IMG/M |
| 3300008001|Ga0100389_1391875 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300008002|Ga0100390_10063228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 2405 | Open in IMG/M |
| 3300009037|Ga0105093_10007703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 4292 | Open in IMG/M |
| 3300009053|Ga0105095_10394772 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300009082|Ga0105099_10019418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3459 | Open in IMG/M |
| 3300009091|Ga0102851_10333874 | All Organisms → cellular organisms → Bacteria | 1498 | Open in IMG/M |
| 3300009091|Ga0102851_10467218 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300009091|Ga0102851_10589609 | Not Available | 1159 | Open in IMG/M |
| 3300009167|Ga0113563_10681603 | Not Available | 1150 | Open in IMG/M |
| 3300009167|Ga0113563_10896353 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300010328|Ga0129298_10182899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 982 | Open in IMG/M |
| 3300010391|Ga0136847_13095053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2564 | Open in IMG/M |
| 3300012931|Ga0153915_10075058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3530 | Open in IMG/M |
| 3300012931|Ga0153915_10455975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Desulfuromonadaceae | 1456 | Open in IMG/M |
| 3300012931|Ga0153915_12608158 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300012931|Ga0153915_13494764 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300012964|Ga0153916_10187360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 2050 | Open in IMG/M |
| 3300012964|Ga0153916_10512705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Desulfuromonadaceae | 1270 | Open in IMG/M |
| 3300012964|Ga0153916_11036665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 900 | Open in IMG/M |
| 3300012964|Ga0153916_11649318 | Not Available | 715 | Open in IMG/M |
| 3300013090|Ga0163209_1002960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 6852 | Open in IMG/M |
| 3300013091|Ga0163210_1129691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 901 | Open in IMG/M |
| 3300017939|Ga0187775_10115754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Desulfuromonadaceae → Desulfuromonas | 918 | Open in IMG/M |
| 3300017939|Ga0187775_10140741 | Not Available | 850 | Open in IMG/M |
| 3300017939|Ga0187775_10311326 | Not Available | 624 | Open in IMG/M |
| 3300017959|Ga0187779_10468153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 830 | Open in IMG/M |
| 3300017961|Ga0187778_10090420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 1896 | Open in IMG/M |
| 3300017966|Ga0187776_10300575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1044 | Open in IMG/M |
| 3300017966|Ga0187776_10446629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 874 | Open in IMG/M |
| 3300017966|Ga0187776_11183067 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300017973|Ga0187780_10033882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3593 | Open in IMG/M |
| 3300017973|Ga0187780_10322522 | Not Available | 1088 | Open in IMG/M |
| 3300017973|Ga0187780_10889354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Desulfuromonadaceae | 646 | Open in IMG/M |
| 3300018029|Ga0187787_10006359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 2827 | Open in IMG/M |
| 3300018029|Ga0187787_10075930 | Not Available | 1040 | Open in IMG/M |
| 3300018029|Ga0187787_10109461 | Not Available | 896 | Open in IMG/M |
| 3300018032|Ga0187788_10013267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 2561 | Open in IMG/M |
| 3300018032|Ga0187788_10056675 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300018032|Ga0187788_10058165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Desulfuromonadaceae | 1327 | Open in IMG/M |
| 3300018032|Ga0187788_10080809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1150 | Open in IMG/M |
| 3300018032|Ga0187788_10464533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300018062|Ga0187784_10059117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3106 | Open in IMG/M |
| 3300018062|Ga0187784_11089298 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300018064|Ga0187773_10298829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Desulfuromonadaceae | 898 | Open in IMG/M |
| 3300018088|Ga0187771_10837662 | All Organisms → cellular organisms → Bacteria → Elusimicrobia → Elusimicrobia | 780 | Open in IMG/M |
| 3300018089|Ga0187774_10608141 | Not Available | 708 | Open in IMG/M |
| 3300020109|Ga0194112_10406243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 984 | Open in IMG/M |
| 3300022556|Ga0212121_10037404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 4197 | Open in IMG/M |
| 3300024056|Ga0124853_1275800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2024 | Open in IMG/M |
| 3300025020|Ga0210030_1040381 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1765 | Open in IMG/M |
| 3300025164|Ga0209521_10074314 | Not Available | 2229 | Open in IMG/M |
| 3300025314|Ga0209323_10103382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 1929 | Open in IMG/M |
| 3300027713|Ga0209286_1017229 | Not Available | 2623 | Open in IMG/M |
| 3300027731|Ga0209592_1285711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 567 | Open in IMG/M |
| 3300027740|Ga0214474_1161490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 830 | Open in IMG/M |
| 3300027811|Ga0256868_10005942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6102 | Open in IMG/M |
| 3300027811|Ga0256868_10032979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 2419 | Open in IMG/M |
| 3300027811|Ga0256868_10172709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 930 | Open in IMG/M |
| 3300027811|Ga0256868_10206120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 836 | Open in IMG/M |
| 3300027885|Ga0209450_10008922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5321 | Open in IMG/M |
| 3300027885|Ga0209450_10433372 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300027900|Ga0209253_10093663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 2465 | Open in IMG/M |
| 3300027900|Ga0209253_10491130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 917 | Open in IMG/M |
| 3300027902|Ga0209048_10023818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 5265 | Open in IMG/M |
| 3300027902|Ga0209048_10396726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 948 | Open in IMG/M |
| 3300030613|Ga0299915_10918626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300031862|Ga0315280_10000134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 137302 | Open in IMG/M |
| 3300031949|Ga0214473_10154365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae | 2669 | Open in IMG/M |
| 3300031997|Ga0315278_10360691 | Not Available | 1502 | Open in IMG/M |
| 3300032020|Ga0315296_10160706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 1376 | Open in IMG/M |
| 3300032053|Ga0315284_10422229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1639 | Open in IMG/M |
| 3300032069|Ga0315282_10009675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 15287 | Open in IMG/M |
| 3300032069|Ga0315282_10093455 | All Organisms → cellular organisms → Bacteria | 2730 | Open in IMG/M |
| 3300032070|Ga0315279_10000652 | All Organisms → cellular organisms → Bacteria | 65305 | Open in IMG/M |
| 3300032118|Ga0315277_11649605 | Not Available | 540 | Open in IMG/M |
| 3300032143|Ga0315292_10104633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 2215 | Open in IMG/M |
| 3300032156|Ga0315295_10192102 | Not Available | 2047 | Open in IMG/M |
| 3300032156|Ga0315295_11139567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Desulfuromonadaceae | 767 | Open in IMG/M |
| 3300032156|Ga0315295_11478912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300032164|Ga0315283_10070522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3581 | Open in IMG/M |
| 3300032516|Ga0315273_10269833 | All Organisms → cellular organisms → Bacteria | 2315 | Open in IMG/M |
| 3300032829|Ga0335070_10920953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 809 | Open in IMG/M |
| 3300033004|Ga0335084_10002292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 18408 | Open in IMG/M |
| 3300033158|Ga0335077_11762425 | Not Available | 583 | Open in IMG/M |
| 3300033408|Ga0316605_10664989 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300033413|Ga0316603_10071434 | All Organisms → cellular organisms → Bacteria | 2631 | Open in IMG/M |
| 3300033414|Ga0316619_11986703 | Not Available | 529 | Open in IMG/M |
| 3300033419|Ga0316601_100308600 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
| 3300033433|Ga0326726_10158380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Desulfuromonadaceae → Desulfuromonas | 2069 | Open in IMG/M |
| 3300033433|Ga0326726_10483161 | Not Available | 1183 | Open in IMG/M |
| 3300033433|Ga0326726_11336927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Desulfuromonadaceae | 697 | Open in IMG/M |
| 3300033480|Ga0316620_10013932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 4520 | Open in IMG/M |
| 3300033480|Ga0316620_10794909 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300033480|Ga0316620_11507368 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300033481|Ga0316600_11042714 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300033485|Ga0316626_10176311 | All Organisms → cellular organisms → Bacteria | 1660 | Open in IMG/M |
| 3300033485|Ga0316626_11834100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300033486|Ga0316624_10108626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1975 | Open in IMG/M |
| 3300033486|Ga0316624_10416788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 1127 | Open in IMG/M |
| 3300033486|Ga0316624_10490966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1048 | Open in IMG/M |
| 3300033489|Ga0299912_10796800 | Not Available | 723 | Open in IMG/M |
| 3300033758|Ga0314868_043023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300033804|Ga0314863_018929 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1384 | Open in IMG/M |
| 3300034078|Ga0373900_024259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1014 | Open in IMG/M |
| 3300034078|Ga0373900_029542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 938 | Open in IMG/M |
| 3300034085|Ga0373908_100006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 573 | Open in IMG/M |
| 3300034419|Ga0373914_0057757 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 20.87% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 13.91% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 12.17% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 6.96% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 6.96% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 6.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.35% |
| Aquifer | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer | 3.48% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 3.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.61% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.74% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.74% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.87% |
| Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 0.87% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 0.87% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.87% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.87% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.87% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.87% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003830 | Groundwater microbial communities from aquifer in Utah, USA - Crystal Geyser 4/9/14 3 um filter | Environmental | Open in IMG/M |
| 3300003859 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR | Environmental | Open in IMG/M |
| 3300003861 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR | Environmental | Open in IMG/M |
| 3300005213 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300007986 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-04 | Environmental | Open in IMG/M |
| 3300008001 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-13 | Environmental | Open in IMG/M |
| 3300008002 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-14 | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300010328 | Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I19B2 metaG | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013090 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_160m | Environmental | Open in IMG/M |
| 3300013091 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_220m | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300022556 | Kivu_combined assembly | Environmental | Open in IMG/M |
| 3300024056 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025020 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-23 (SPAdes) | Environmental | Open in IMG/M |
| 3300025164 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4 | Environmental | Open in IMG/M |
| 3300025314 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2 | Environmental | Open in IMG/M |
| 3300027713 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027731 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027740 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 HiSeq | Environmental | Open in IMG/M |
| 3300027811 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 HiSeq | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300030613 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 | Environmental | Open in IMG/M |
| 3300031862 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032020 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_18 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032069 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20 | Environmental | Open in IMG/M |
| 3300032070 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_20 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033489 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 | Environmental | Open in IMG/M |
| 3300033758 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_A | Environmental | Open in IMG/M |
| 3300033804 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_20 | Environmental | Open in IMG/M |
| 3300034078 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A0.1 | Engineered | Open in IMG/M |
| 3300034085 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B3A4.3 | Engineered | Open in IMG/M |
| 3300034419 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B5A4.3 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0051980_101296182 | 3300003830 | Groundwater | MKGVDRIGRTDPKKKISSFSISYKSLCTTFPQLWINEIKDKEGKN* |
| Ga0031653_100338611 | 3300003859 | Freshwater Lake Sediment | MKGVDGMGGTXPKKKISSFSISYKSLCTMFPQLWINEIKAKEGK |
| Ga0031654_101269922 | 3300003861 | Freshwater Lake Sediment | MKGIDGMGGTHPKKKISSFSISYRSLCTMFPHLWINEIKDKEGKN* |
| Ga0068998_101895682 | 3300005213 | Natural And Restored Wetlands | LKCLAKGVDRIGRTGPEKKISSFSISYKSLCTMFPQLWINEIKDKEGK |
| Ga0074472_112390112 | 3300005833 | Sediment (Intertidal) | MKGVDRSGRTDPEKKISSFSISYKSLCTMFPQLWINEIKDKEGKIFAD* |
| Ga0079037_1003645682 | 3300006224 | Freshwater Wetlands | MKGIDGMDRTDPKKKIFSFSISYKSLCTTFPQLWINEIKDKEGKN* |
| Ga0079037_1025202541 | 3300006224 | Freshwater Wetlands | MGRADPKKKISSFLMSYKSLCTIFPQLWINEIKTKRGK |
| Ga0100380_103575331 | 3300007986 | Aquifer | IGRTDPKKKISSFSISYKSLCTTFPQLWINEIKDKEGKN* |
| Ga0100389_13918752 | 3300008001 | Aquifer | CCMKGVDRIGRTDPKKKISSFSISYKSLCTTFPQLWINEIKDKEGKN* |
| Ga0100390_100632282 | 3300008002 | Aquifer | MKGVDRIGRTDPKKKISSFSISYKSLCTTFPHLWINEIKDKEGKN* |
| Ga0105093_100077032 | 3300009037 | Freshwater Sediment | MGIDGMGEEGPKKEISSFSISYKSLCTMFPQLWINEIRDKEGEKLRMNS* |
| Ga0105095_103947722 | 3300009053 | Freshwater Sediment | MGIDGMGEESPKKEISSFSISYKSLCTMFPQLWIKEIRDKEGEKLRMNS* |
| Ga0105099_100194183 | 3300009082 | Freshwater Sediment | MGIDGMGEEGPKKEIYSFSISYKSLCTMFPQLWINEIRDKEGEKLRMNS* |
| Ga0102851_103338741 | 3300009091 | Freshwater Wetlands | LTTGVDRIGRTDPEKKISSFSISYKSLCTMFPQLWINEIKDKEGKVFED* |
| Ga0102851_104672182 | 3300009091 | Freshwater Wetlands | GGTHPKQKISSFSISYKSLCTMFPQLWINEIKDKEGKFFEDYNF* |
| Ga0102851_105896091 | 3300009091 | Freshwater Wetlands | CLTTGVDRIGRTDPEKKISSFSISYKSLCTMFPQLWINEIRDKEGKIFED* |
| Ga0113563_106816031 | 3300009167 | Freshwater Wetlands | TGVDRIGRTDPEKKISSFSISYKSLCTMFPQLWINEIRDKEGKIFED* |
| Ga0113563_108963532 | 3300009167 | Freshwater Wetlands | LTEGVDRTGRTDPEKKISSFSISYKSLCTMFPQLWINEIKDKEGKVFED* |
| Ga0129298_101828992 | 3300010328 | Lake Sediment | MKVIYGVGRTDPEKKISSFSMTYKSLFTMFPQMWINETKQKRGE* |
| Ga0136847_130950532 | 3300010391 | Freshwater Sediment | MKGVDGMGGTHPKKKISSFSISYKSLCTMFPQLWINEIKAKEGKN* |
| Ga0153915_100750584 | 3300012931 | Freshwater Wetlands | LSDRIGRTDPEEKISSFSISYMSLCTTFPQLWINEIKDKEGKIFED* |
| Ga0153915_104559752 | 3300012931 | Freshwater Wetlands | MKGVDRTGRTDPEKKISSFSISYKSLCTMFPQLWINEIKDKEGKNFED* |
| Ga0153915_126081582 | 3300012931 | Freshwater Wetlands | FDGTGGTNPKKKISSFLMSYKSLCTTFPQMWINEIKTKRGKFLRIKIL* |
| Ga0153915_134947641 | 3300012931 | Freshwater Wetlands | GVDRIGRTDPEKKISSFSISYKSLCTMFPQLWINEIKDKEGKIFAD* |
| Ga0153916_101873602 | 3300012964 | Freshwater Wetlands | MKVIDEMGWTEPKKKTFSFSIIYKSLFTMFPQLWINEIKNQRGELFGD* |
| Ga0153916_105127052 | 3300012964 | Freshwater Wetlands | MKLIYEMGGMDPKKKISSFSISYKALFTMFPQLWINEIKNLRGEKIWGLKSFLLY* |
| Ga0153916_110366652 | 3300012964 | Freshwater Wetlands | LKGIDGMGRTDPEKKISSFSIGYKSLCTMFPQLWINEIKDKEGKIFED* |
| Ga0153916_116493182 | 3300012964 | Freshwater Wetlands | MTGVDGIGWTDPEKKISSFSISYKSLCTKFPQLWINEIKDKEGKN* |
| Ga0163209_10029606 | 3300013090 | Freshwater | MKIIDEMGWTEPKKKTFSFLISYKSLFTIFPQLWINEIKSQRGELFGD* |
| Ga0163210_11296912 | 3300013091 | Freshwater | MKIIDEMGWTEPKKKTFSFLISYKSLFTIFPQLWINEIK |
| Ga0187775_101157542 | 3300017939 | Tropical Peatland | MKGVDRAGRTNPERKILSFSISYKSLCTMFPQLWINEIKDKEGKFFEDESF |
| Ga0187775_101407412 | 3300017939 | Tropical Peatland | MTGVDGIGWTDPKKKISSFSISYKSLCTTFPQLWINEFKDKEGINFED |
| Ga0187775_103113262 | 3300017939 | Tropical Peatland | MKGVDRTGRTDPEKKISSFSISYKSLCTTFPQLWINEIKDKKGKIIED |
| Ga0187779_104681531 | 3300017959 | Tropical Peatland | MKGVDRIGRTDPEKKICSFSISYKSLCTMFPQLWINEIKDKEGRNLGD |
| Ga0187778_100904202 | 3300017961 | Tropical Peatland | MKGVDKMGRTDPEKKISSFSISYKSLCTMFPQLWINEIKDKEGKIFGD |
| Ga0187776_103005752 | 3300017966 | Tropical Peatland | MKGIGKTGRTDPKKRILSFSISYKSLCTMFPQLWINEIKDEKRNNFWGYKF |
| Ga0187776_104466292 | 3300017966 | Tropical Peatland | MKGVDRMGRTDPEKKISSFSISYKSLCTMFPQLWINEIKDKEGKFFGD |
| Ga0187776_111830672 | 3300017966 | Tropical Peatland | MTGVDGIGWTDPKKKISSFSISYKSLCTMFPQLWINEIKDKEGKN |
| Ga0187780_100338821 | 3300017973 | Tropical Peatland | MGRTYPEKKTSSFSISYKSLCTTFPQLWINEIKDKEGKIFEDLALENSR |
| Ga0187780_103225221 | 3300017973 | Tropical Peatland | LRWTRGVGGTGRTSPRKKISSFSVSYKSLCTTFPQLWINEIKDKEGINFGD |
| Ga0187780_108893542 | 3300017973 | Tropical Peatland | MKGVDRIGRTDPEEKICSFSISYKSLCTMFPQLWINEIKDKEGRNLGD |
| Ga0187787_100063592 | 3300018029 | Tropical Peatland | MKGVERTGRTALERKTFSFSISYKSLCTTFPQLWINEIKDKEGKIIED |
| Ga0187787_100759302 | 3300018029 | Tropical Peatland | MKGVDRTGRTDPEKKISSFSISYKSLCTIFPQLWINEIKDKEGKIFGD |
| Ga0187787_101094611 | 3300018029 | Tropical Peatland | MTGVDGIGWTDPKKKISSFSISYKSLCTMFPQLWINEIKDKE |
| Ga0187788_100132673 | 3300018032 | Tropical Peatland | MKGVERTGRTALERKIFSFSISYKSLCTTFPQLWINEIKDKEGKIIED |
| Ga0187788_100566752 | 3300018032 | Tropical Peatland | MKGVDRAGRTNPERKILSFSISYKSLCTMFPQLWINEIRDKEGKFFEDESF |
| Ga0187788_100581652 | 3300018032 | Tropical Peatland | MKGVDRTGRTDPEKKISSFSISYKSLCTTFPQLWIKEIKDKEGKIIED |
| Ga0187788_100808091 | 3300018032 | Tropical Peatland | MKGVDRTGRTDPEKKISSFSTSYKSLCTMFPQLWINEIKDKEGKIFGD |
| Ga0187788_104645332 | 3300018032 | Tropical Peatland | MKGVDRAGRTNPERKILSFSISYKSLCTMFPQLWINEIKDKEG |
| Ga0187784_100591171 | 3300018062 | Tropical Peatland | MGRTDPKKKTYSFSISYKSLCTTFPQLWINEIKDKEGINFE |
| Ga0187784_110892982 | 3300018062 | Tropical Peatland | KTSSFSISYKSLCTTFPQLWINEIKDKEGKIFEVKALESSRR |
| Ga0187773_102988292 | 3300018064 | Tropical Peatland | MKGVDRTGRTDPEKKISSFSISYKSLCTTFPQLWINEIKDKEGKIIED |
| Ga0187771_108376621 | 3300018088 | Tropical Peatland | MKVIFGMGRTNPKKKIYSFSITYESLFTMFPQLWINEIKKQRGEKMLGIKFLIKR |
| Ga0187774_106081412 | 3300018089 | Tropical Peatland | MKGIDRTGRVDTEKKISSFSISYKSLCTMFPQLWINEIKDKEGKTFED |
| Ga0194112_104062431 | 3300020109 | Freshwater Lake | MKGIDGMDRTDPKKKTFSFSMSYISLCTTFPQLWINEIKDKEGKKLRIN |
| Ga0212121_100374041 | 3300022556 | Anoxic Lake Water | MKIIDEMGWTEPKKKTFSFLISYKSLFTIFPQLWINEIKSQRGELFGD |
| Ga0124853_12758001 | 3300024056 | Freshwater Wetlands | IGRTDPEKKISSFSISYKSLCTMFPQLWINEIKDKEGKVLRIKVF |
| Ga0210030_10403812 | 3300025020 | Aquifer | MKGVDRIGRTDPKKKISSFSISYKSLCTTFPQLWINEIKDKEGKN |
| Ga0209521_100743142 | 3300025164 | Soil | MKGVDRTGRTDPEKKISSFSISYKSLCTMFPQLWINEIKDKEGKFFED |
| Ga0209323_101033822 | 3300025314 | Soil | MKGVDRTGRTDPEKKISSFSISYKSLCTMFPQLWINEIKDKEGKIFGD |
| Ga0209286_10172293 | 3300027713 | Freshwater Sediment | MGIDGMGEEGPKKEISSFSISYKSLCTMFPQLWINEIRDKEGEKLRMNS |
| Ga0209592_12857112 | 3300027731 | Freshwater Sediment | MGIDGMGEESPKKEISSFSISYKSLCTMFPQLWIKEIRDKEGEKLRMNS |
| Ga0214474_11614902 | 3300027740 | Soil | GLKCWMKGVEGMGGTHPKKKISSFSISYKSLCTMFPQLWINEIKAKEGKN |
| Ga0256868_100059421 | 3300027811 | Soil | GVSDGIGRTDPKKKTSSFSISYMSLCTTFPQLWINEITDKEGKIFED |
| Ga0256868_100329793 | 3300027811 | Soil | MKGVEGMGGTHPKKKISSFSISYKSLCTMFPQLWINEIKAKEGKN |
| Ga0256868_101727092 | 3300027811 | Soil | MKGVDGIGRTDPKKKISSFSISYKSLCTMFPQLWINEI |
| Ga0256868_102061202 | 3300027811 | Soil | MKLIYEMGGMDPKKKISSFSISYKSLFTLFPQLWINEIKNKEGKRFGD |
| Ga0209450_100089224 | 3300027885 | Freshwater Lake Sediment | MKGIDGMDRTDPKKKIYSFSISYKSLCTTFPQLWINEIKDKE |
| Ga0209450_104333721 | 3300027885 | Freshwater Lake Sediment | MKGIDGMDRTDPKKKIYSFSISYKSLCTTFPQLWINEIKDKEGKN |
| Ga0209253_100936633 | 3300027900 | Freshwater Lake Sediment | MKGVDRTVRTDPEKKISSFSISYKSLCTMFPQLWINEIKDKE |
| Ga0209253_104911301 | 3300027900 | Freshwater Lake Sediment | MKGVDGMGGTPPKKKISSFSISYKSLCTMFPQLWINEIKAKEGKN |
| Ga0209048_100238184 | 3300027902 | Freshwater Lake Sediment | MESTLGLKCWMKGIDGMGGTHPKKKISSFSISYRSLCTMFPHLWINEIKDKEGKN |
| Ga0209048_103967262 | 3300027902 | Freshwater Lake Sediment | MKVIDEMGWTEPKKKTFSFSISYKSLFTMFPQLWINEIKNQRGELFGD |
| Ga0299915_109186262 | 3300030613 | Soil | VKPWAKGIDEMGGTTHKKKISSFSVIYKSLCTMFPQLWINEIRDKEGKNFEDLIF |
| Ga0315280_10000134119 | 3300031862 | Sediment | MKVIDEMGWTEPKKKTFSFSIIYKSLFTMFPQLWINEIKNQRGELFGD |
| Ga0214473_101543653 | 3300031949 | Soil | MKGVDRTVRTDPEKKISSFSISYKSLCTMFPQLWINEIKDKEGKFFED |
| Ga0315278_103606912 | 3300031997 | Sediment | VKVIYGTGRTDPKKKISSFSMTYKSLFTMFPQMWINELKNQRGEKVGD |
| Ga0315296_101607062 | 3300032020 | Sediment | MKVIDEMGWAEPKKKTFSFSISYKSLFTMFPQLWINEIKNQRGELFGD |
| Ga0315284_104222291 | 3300032053 | Sediment | MKVIDEMGWTEPKKKTFSFSISYKSLFTMFPQLWINEIKNQRGE |
| Ga0315282_100096755 | 3300032069 | Sediment | MKVIDEMGWIDPKKKTFSFSISYKSLFTMFPQLWINEIKNQRGEKFGD |
| Ga0315282_100934553 | 3300032069 | Sediment | MKGIDGMGRTDPKKKISSFSISYKSLCTMFPQLWINEIKDKEGKKLRII |
| Ga0315279_1000065229 | 3300032070 | Sediment | MKVIDEMGWTEPKKRTFSFSISYKSLFTMFPQLWINEIKNQRGELFGD |
| Ga0315277_116496052 | 3300032118 | Sediment | TGRADPKKKTSSFLMSYKSLCTIFPQMWINEIKTKRGKFLRIKIF |
| Ga0315292_101046332 | 3300032143 | Sediment | VKVIYGTGRTDPKKKISSFSMTYKSLFTMFPQMWINEIKNQRGEKVGD |
| Ga0315295_101921022 | 3300032156 | Sediment | MKGVDGMGGTHPKKKISSFSISYKSLCTMFPQLWINEIKAKEGKN |
| Ga0315295_111395672 | 3300032156 | Sediment | MTGVDGIGWTDPEKKISSFSISYKSLCTMFPQLWINEIKDKEGKN |
| Ga0315295_114789122 | 3300032156 | Sediment | MKVIDEMGWTEPKKKIFSFSTSYKFLFTMFPQLWINEIKNQRGELFGD |
| Ga0315283_100705224 | 3300032164 | Sediment | VKVIYGTGRTDPKKKISSFSMTYKSLFTMFPQMWINEIKNQ |
| Ga0315273_102698332 | 3300032516 | Sediment | VKVIYGTGRTDPKKKISSFSMTYKSLFTMFPQMWINEFKNQRGEKVGD |
| Ga0335070_109209531 | 3300032829 | Soil | KCLMKGVDRAGRTNPERKIHSFSISYKSLCTMFPQLWINEIKDKEGKFFEDESF |
| Ga0335084_1000229211 | 3300033004 | Soil | MRGVERNGRTALERKTSSFSISYKSLCTTFPQLWINEIKDKEGKIIED |
| Ga0335077_117624251 | 3300033158 | Soil | HGTGLDSLKCLMKGVDRIGRTDPEKKICSFSISYKSLCTMFPQLWINEIKDKEGRNLGD |
| Ga0316605_106649891 | 3300033408 | Soil | TDPEKKISSFSISYKSLCTMFPQLWINEIKDKEGKVFED |
| Ga0316603_100714342 | 3300033413 | Soil | IGRTDPEKKISSFSISYKSLCTMFPQLWINEIRDKEGKIFED |
| Ga0316619_119867031 | 3300033414 | Soil | KGVDGIGGTHPKQKISSFSISYKSLCTMFPQLWINEIKDKEGKFFEDYNF |
| Ga0316601_1003086001 | 3300033419 | Soil | IGGTHPKQKISSFSISYKSLCTMFPQLWINEIKDKEGKFFEDTNF |
| Ga0326726_101583802 | 3300033433 | Peat Soil | MKGVDGTGRTDPEKKISSFSISYKSLCTTFPQLWINEIKDKEGKILED |
| Ga0326726_104831611 | 3300033433 | Peat Soil | TGVDGIGWTDPEKKISSFSISYKSLCTTFPQLWINEIKDKEGKY |
| Ga0326726_113369272 | 3300033433 | Peat Soil | MTGVDGIGWIDPEKKISSFSISYKSLCTMFPQLWINEIKDKEGKFFGD |
| Ga0316620_100139322 | 3300033480 | Soil | MKGVDGTGRTDPEKKISSFSISYKSLCTMFPQLWINEIKDKEGKIFGD |
| Ga0316620_107949092 | 3300033480 | Soil | MKGIDGMDRTDPKKKIYSFSISYKSLCTTFPQLWINEIKDKEGINFED |
| Ga0316620_115073682 | 3300033480 | Soil | KYWTKVFDGMGRTDPKRNISSFSVSYKSLCTMFPQLWINEIKDKEGKN |
| Ga0316600_110427141 | 3300033481 | Soil | IGRTDPEKKISSFSISYKSLCTMFPQLWINEIKDKEGKVFED |
| Ga0316626_101763112 | 3300033485 | Soil | GVDRIGRTDPEKKISSFSISYKSLCTMFPQLWINEIKDKEGKVFED |
| Ga0316626_118341002 | 3300033485 | Soil | MKGIDGMDRTDPKKKIFSFSISYKSLCTTFPQLWINEIKDKEGKN |
| Ga0316624_101086263 | 3300033486 | Soil | LIKGVDGTGRTDPEKKISSFSISYKSLCTMFPQLWINEIKDKEGKIFGD |
| Ga0316624_104167882 | 3300033486 | Soil | MKGVDRTGRTDPEKKISSFSLSYKSLCTMFPQLWINEIKDKEGKFFGD |
| Ga0316624_104909662 | 3300033486 | Soil | MKGVDGTGRTDPEKKISSFSISYKSLCTMFPQLWINEIKDKEGKIFED |
| Ga0299912_107968002 | 3300033489 | Soil | MKVIDRMGRLKPKWKSSSFLITYKSLFTMFPQLWINEIKKQSGEKI |
| Ga0314868_043023_209_349 | 3300033758 | Peatland | MGVDNLGRTDPKKKTSSFSISCNSLCTLFPQMWIKEFKTKRGKIED |
| Ga0314863_018929_389_544 | 3300033804 | Peatland | MKVIDQTGWIETEKKTFSFSISYKSLFTMFPQLWISEIKNQRGEKIWGLEY |
| Ga0373900_024259_377_535 | 3300034078 | Sediment Slurry | LKCYARGVGGTGRTGPKKKISSFSISYKSLCTTFPQLWINEIKDKEGINFED |
| Ga0373900_029542_761_898 | 3300034078 | Sediment Slurry | MKGIDGMDRTDPKKKIYSFSISYKSLCTAFPQLWINEIKDKEGKN |
| Ga0373908_100006_309_446 | 3300034085 | Sediment Slurry | MKGIDGMGGTHPKKKISSFSISYRSLCTMFPHLWINEIKDKEGKN |
| Ga0373914_0057757_258_395 | 3300034419 | Sediment Slurry | MKGIDGMGKEGPKKKIYSFSISYESLCTMFPQLWINEIKDKEGKN |
| ⦗Top⦘ |