Scaffold Ga0062512_11372

Overview

Basic Information

• Taxon OID: 3300003743
• Scaffold ID: Ga0062512_11372
• Source Dataset Name: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS904_80_12H
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Marine Biological Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 565
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Source Dataset Sampling Location

• Location Name: Marker 33 diffuse flow vent, Axial Seamount
• Coordinates
  • Lat. (^o): 45.9332
  • Long. (^o): -129.982268
  • Depth (m): 1516

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010914	Metagenome / Metatranscriptome	297	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0062512_113722	F010914	AGG	MIYNILTEQNGKFVDSGETVDCEFEETQAVIDELHLEHGCCCALEAVSE*