NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003743

3300003743: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS904_80_12H



Overview

Basic Information
IMG/M Taxon OID3300003743 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0111355 | Gp0109408 | Ga0062512
Sample NameDiffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS904_80_12H
Sequencing StatusPermanent Draft
Sequencing CenterMarine Biological Laboratory
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size1875723
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pneumoniae2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDiffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine hydrothermal vent biomemarine hydrothermal venthydrothermal fluid
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationMarker 33 diffuse flow vent, Axial Seamount
CoordinatesLat. (o)45.9332Long. (o)-129.982268Alt. (m)N/ADepth (m)1516
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010914Metagenome / Metatranscriptome297Y
F045749Metagenome / Metatranscriptome152Y
F074867Metagenome / Metatranscriptome119N
F078696Metagenome / Metatranscriptome116N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0062512_10694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pneumoniae851Open in IMG/M
Ga0062512_11218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pneumoniae594Open in IMG/M
Ga0062512_11372All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria565Open in IMG/M
Ga0062512_12263All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage581Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0062512_10694Ga0062512_106941F074867MSSRGITDIILNGEAFELHPTFSNLDKLETVLNKGAIGFLRQDLSSGAFKAGDVVCIIQVCAVPANGRKFPNWWNRDGVGEAVIGAGLVGITTSVTHFLAKALTAGTETDIKTVGSESDEKK*
Ga0062512_11218Ga0062512_112182F078696MKLWSSAVTYLNVQPSEAWNLTPFEFWALWDTHLEKMEISTGKAYTRPMTMDEFNELSDFLDGLHGDN*
Ga0062512_11372Ga0062512_113722F010914MIYNILTEQNGKFVDSGETVDCEFEETQAVIDELHLEHGCCCALEAVSE*
Ga0062512_12263Ga0062512_122631F045749QNEAELFNYFGGREQTADYFENLFAESEKHAGVIKGFLLKYNISEDFKASGRAPDTSSRQAMIQATISPEQCSVEDLINKHECSVVNGRILDVTWLNELCVIDGDMLPPTRTLGHILSDMGYSQIEGRRVKIQKTRENHYIWFKNVAGAASSDVIEQVRDFFKKGLDEVPF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.