Basic Information | |
---|---|
Taxon OID | 3300003732 Open in IMG/M |
Scaffold ID | Ga0006241_102116 Open in IMG/M |
Source Dataset Name | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome C0912_C43A7_80 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 728 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Monterey Bay, California, USA | |||||||
Coordinates | Lat. (o) | 36.46 | Long. (o) | -122.78 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F015413 | Metagenome / Metatranscriptome | 255 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0006241_1021161 | F015413 | N/A | MESTELEKQVNDLLNTKFEQPEFEQLLPKGLLGKDMLIGSAGTALAVQMGNIVGKFLPIGQLPSGTSSILAGVLMQKFLGKNGNLKKLSEGVIQGGIATALTPFVSGLIPAQFQQVEKQVETATETINPTMQGVMW* |
⦗Top⦘ |