| Basic Information | |
|---|---|
| Taxon OID | 3300003691 Open in IMG/M |
| Scaffold ID | JT63_1027053 Open in IMG/M |
| Source Dataset Name | Combined assembly of microbial communities in oil-polluted sediment from the Gulf of Mexico |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Argonne National Laboratory |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2625 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated Sediment → Marine Sediment → Oil-Polluted Seafloor Microbial Communities From The Gulf Of Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Gulf of Mexico, USA | |||||||
| Coordinates | Lat. (o) | 28.74511 | Long. (o) | -88.35914 | Alt. (m) | Depth (m) | 0 to .01 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F025922 | Metagenome / Metatranscriptome | 199 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JT63_10270534 | F025922 | AGGAG | MARNRIIYASQSVWCNGDLLYRVQSLGSTTTFTSEDIFELGHLDIIDVVDDVPSVAVTLNTNDFGDVTTFATLAQVLPARRAMDATASISNSNLEVVDASLTGIGTYLHGVCVPDFAIACGALPGVSIWAPVQEECSLGSLADNI |
| ⦗Top⦘ |