Scaffold JT63_1016469

Overview

Basic Information

• Taxon OID: 3300003691
• Scaffold ID: JT63_1016469
• Source Dataset Name: Combined assembly of microbial communities in oil-polluted sediment from the Gulf of Mexico
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Argonne National Laboratory
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 3527
• Total Scaffold Genes: 17
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (35.29%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated Sediment → Marine Sediment → Oil-Polluted Seafloor Microbial Communities From The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Gulf of Mexico, USA
• Coordinates
  • Lat. (^o): 28.74511
  • Long. (^o): -88.35914
  • Depth (m): 0 to .01

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009686	Metagenome / Metatranscriptome	314	Y

Sequences

Protein ID	Family	RBS	Sequence
JT63_101646912	F009686	N/A	MFEKSFQRPTNYFNLEEERQWAIDKSLGILDWQGDNLNTEDLLRYAEHYE*