NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0003069J53074_1012803

Scaffold Ga0003069J53074_1012803


Overview

Basic Information
Taxon OID3300003680 Open in IMG/M
Scaffold IDGa0003069J53074_1012803 Open in IMG/M
Source Dataset NameGroundwater microbial communities from S. Glens Falls, New York, USA - water-only treatment rep 3 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4073
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Leviviricetes → Norzivirales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater → Groundwater Microbial Communities From Coal-Tar-Waste-Contaminated Well In S. Glens Falls, New York, Usa

Source Dataset Sampling Location
Location NameS. Glens Falls, New York, USA
CoordinatesLat. (o)43.099444Long. (o)-73.604444Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025292Metagenome / Metatranscriptome202Y

Sequences

Protein IDFamilyRBSSequence
Ga0003069J53074_10128033F025292AGGMAFGLTSPLTGAAQTGFTAPTYTLTPDTAPDVNGKQWAVTALGGTQTGVTTHSVASPFTQSAFRPKNFKVLGKTNPVTGLVSNVPMNTHKVITRKGVLPLSGQPYKNLNITTVIDIPAGSDTADPANVRAAFSAHIGALYQQAAGLGDTAITGIL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.