Basic Information | |
---|---|
Taxon OID | 3300003680 Open in IMG/M |
Scaffold ID | Ga0003069J53074_1004200 Open in IMG/M |
Source Dataset Name | Groundwater microbial communities from S. Glens Falls, New York, USA - water-only treatment rep 3 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 642 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater → Groundwater Microbial Communities From Coal-Tar-Waste-Contaminated Well In S. Glens Falls, New York, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | S. Glens Falls, New York, USA | |||||||
Coordinates | Lat. (o) | 43.099444 | Long. (o) | -73.604444 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F091449 | Metagenome / Metatranscriptome | 107 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0003069J53074_10042001 | F091449 | N/A | ASLQHMRHRRYAFHGLCLPATFRLQGLATLLAVYSLRSRAGFVSHRPRSWDLPFGAFSSWKVTGRFRLGRTHIPFTRRYTLAPRCRGRLDKPQFLGFDPSESSWQSDVCLIRRLLVAPLGLTLPGYLTKALTRISPSLLSRASQQGLRLTAGASEFRSAFAPPHPPA* |
⦗Top⦘ |