NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0003067J53075_110850

Scaffold Ga0003067J53075_110850


Overview

Basic Information
Taxon OID3300003678 Open in IMG/M
Scaffold IDGa0003067J53075_110850 Open in IMG/M
Source Dataset NameGroundwater microbial communities from S. Glens Falls, New York, USA - water-only treatment rep 1 (Metagenome Metatranscriptome, Counting Only)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)673
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater → Groundwater Microbial Communities From Coal-Tar-Waste-Contaminated Well In S. Glens Falls, New York, Usa

Source Dataset Sampling Location
Location NameS. Glens Falls, New York, USA
CoordinatesLat. (o)43.099444Long. (o)-73.604444Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029638Metagenome / Metatranscriptome187Y

Sequences

Protein IDFamilyRBSSequence
Ga0003067J53075_1108501F029638N/AVDITVTAPATTAPGSFAGSLIGQVIPATATVGTRIQCVPSNVNGFNGSTITIRKIDQFGQPLTAGFSIQQGPFWVEVARVSLGSTLASNPCATDGTQGSFNITGAGTSCANIGVITPAPFLSGLPAGQYRVVEVSGPNSYCTLVQVYNGNQAQNQSNTSAYNSGLLTQPVTLNLPDANIYDLQLTFVNSCVTPGGPSTATSQIAVVIGGSTPGLVNTSNIEIS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.