Scaffold Ga0003067J53075_106289

Overview

Basic Information

• Taxon OID: 3300003678
• Scaffold ID: Ga0003067J53075_106289
• Source Dataset Name: Groundwater microbial communities from S. Glens Falls, New York, USA - water-only treatment rep 1 (Metagenome Metatranscriptome, Counting Only)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2756
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Leviviricetes → Norzivirales → Fiersviridae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater → Groundwater Microbial Communities From Coal-Tar-Waste-Contaminated Well In S. Glens Falls, New York, Usa

Source Dataset Sampling Location

• Location Name: S. Glens Falls, New York, USA
• Coordinates
  • Lat. (^o): 43.099444
  • Long. (^o): -73.604444

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028190	Metagenome / Metatranscriptome	192	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0003067J53075_1062892	F028190	AGGA	MPAMASIVVKKFDGTTDITYDSLSASGGDSSPAVWRQDTGAAAGLPIGFRSLFKLWTTWNGPKTARQTKFNFVAPYAVQDSTTTLYSAKDRVVVDGIMTVPQGIPSANINEAIYQACNLLAAALVKQAASAGYAPT*