| Basic Information | |
|---|---|
| Taxon OID | 3300003672 Open in IMG/M |
| Scaffold ID | Ga0001194_100578 Open in IMG/M |
| Source Dataset Name | Estuarine microbial mat communities from Elkhorn Slough, Moss Landing, CA, USA - CR2A Metatranscriptome (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 543 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Mat Communities From Elkhorn Slough, Moss Landing, Ca, That Are H2-evolving And Photosynthetic |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Elkhorn Slough, Moss Landing, CA | |||||||
| Coordinates | Lat. (o) | 33.8 | Long. (o) | -121.8 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F035643 | Metagenome / Metatranscriptome | 171 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0001194_1005781 | F035643 | N/A | GMHRTEHCNRWRRAHHLSAPQRVFSPPAGSMLSGTPRAAIDQGRSLVTAFRSPVTAAPSRSPHPKVNVPGLLLRNLPPGRTARSDFRSATASGSPRTAAASSRQSRCSASTRFERLLPRSPLPFGPVTSLRIKAFNHIGCHSARLPASPDFLSLPEACSIPRPASDHRSRFATFPKACCS |
| ⦗Top⦘ |