| Basic Information | |
|---|---|
| Taxon OID | 3300003666 Open in IMG/M |
| Scaffold ID | L3E_1000918 Open in IMG/M |
| Source Dataset Name | Lithgow State Coal Mine Metagenomic Study (LSCM3 Early) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 10549 |
| Total Scaffold Genes | 15 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 13 (86.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water → Coalbed Water Microbial Communities From The Lithgow State Coal Mine, New South Wales, Australia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lithgow | |||||||
| Coordinates | Lat. (o) | -33.460524 | Long. (o) | 150.168149 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F101218 | Metagenome / Metatranscriptome | 102 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| L3E_100091814 | F101218 | GGAGG | MSKRGPKPDLPRVKEPPPLPSLDELIAESRALGWDDLADSMEKLRHLETPKGQEALERREKRLSRL* |
| ⦗Top⦘ |