Scaffold LSCMMerge_1028550

Overview

Basic Information

• Taxon OID: 3300003660
• Scaffold ID: LSCMMerge_1028550
• Source Dataset Name: Coalbed water microbial communities from the Lithgow State Coal Mine, New South Wales, Australia (LSCM Merged)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 973
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water → Coalbed Water Microbial Communities From The Lithgow State Coal Mine, New South Wales, Australia

Source Dataset Sampling Location

• Location Name: Lithgow
• Coordinates
  • Lat. (^o): -33.460524
  • Long. (^o): 150.168149

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059998	Metagenome / Metatranscriptome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
LSCMMerge_10285501	F059998	N/A	MTESEKLNQALIEDLAERELDKLNPTLSGQPLTEKAKKYFLSEIRSRRWELGRGRQVTPLTETGAIVSDAHGWPVPFSDVIREIAGEIFELPEKKTTVGVMTQDEYISAMR