Scaffold LSCMMerge_1011210

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold LSCMMerge_1011210

Scaffold LSCMMerge_1011210

Overview

Basic Information
Taxon OID	3300003660 Open in IMG/M
Scaffold ID	LSCMMerge_1011210 Open in IMG/M
Source Dataset Name	Coalbed water microbial communities from the Lithgow State Coal Mine, New South Wales, Australia (LSCM Merged)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2113
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (60.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water → Coalbed Water Microbial Communities From The Lithgow State Coal Mine, New South Wales, Australia

Source Dataset Sampling Location
Location Name	Lithgow
Coordinates	Lat. (^o)	-33.460524	Long. (^o)	150.168149	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105255	Metagenome / Metatranscriptome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
LSCMMerge_10112102	F105255	N/A	MENETFTKLVDKHASPLLIRKYTHWGFPIYVGMITDDDLTTLDNVVVAFMKANKTDGWVNDIQKLRNMAGALTEHLNDTFEKSEGVAVVFYVDKCFISSLHGDFMNHTACRIEFYGLLQMSTGV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.