Scaffold SLW08_101524

Overview

Basic Information

• Taxon OID: 3300003654
• Scaffold ID: SLW08_101524
• Source Dataset Name: Subglacial freshwater microbial communities from Lake Whillans, Antarctica - 0.8 micron filter
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2958
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Subglacial Freshwater → Subglacial Freshwater Microbial Communities From Lake Whillans, Antarctica

Source Dataset Sampling Location

• Location Name: West Antarctica
• Coordinates
  • Lat. (^o): -84.24
  • Long. (^o): -153.694
  • Depth (m): 800

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007365	Metagenome / Metatranscriptome	352	Y

Sequences

Protein ID	Family	RBS	Sequence
SLW08_1015241	F007365	N/A	MNYSMKEMAIRDYISSVDFKSNDWSHNKICEDMKVFLGEIPSFECFYKKDVMVNEVSGESKEFVTVDKIQIVFTDLDSKFKKLEFIIGDKI*