| Basic Information | |
|---|---|
| Taxon OID | 3300003653 Open in IMG/M |
| Scaffold ID | SLW02_102690 Open in IMG/M |
| Source Dataset Name | Subglacial freshwater microbial communities from Lake Whillans, Antarctica - 0.2 micron filter |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1396 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Subglacial Freshwater → Subglacial Freshwater Microbial Communities From Lake Whillans, Antarctica |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | West Antarctica | |||||||
| Coordinates | Lat. (o) | -84.24 | Long. (o) | -153.694 | Alt. (m) | Depth (m) | 800 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009741 | Metagenome / Metatranscriptome | 313 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| SLW02_1026903 | F009741 | GAGG | MTNSVDGRYDRTKPWSTFRSPVLPDQVAKKYSYQGPWATNMERLTQQALMIMTIPGADIQAMVRPPLPQIRLFPDRFGYGFRGQPGIADVVTIDRQYHEPRISWFSGSPAGYSGAARNDLGGI* |
| ⦗Top⦘ |